BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30422 (542 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC16A11.08 |atg20||sorting nexin Atg20|Schizosaccharomyces pom... 26 3.1 SPAC26A3.15c |nsp1||nucleoporin Nsp1|Schizosaccharomyces pombe|c... 25 5.5 SPBC947.12 |kms2||spindle pole body protein Kms2|Schizosaccharom... 25 7.2 SPAC664.03 |||RNA polymerase II associated Paf1 complex |Schizos... 25 7.2 SPAC922.06 |||short chain dehydrogenase|Schizosaccharomyces pomb... 25 9.5 SPBC18H10.06c |swd2|swd2.1|COMPASS complex subunit Swd2|Schizosa... 25 9.5 >SPCC16A11.08 |atg20||sorting nexin Atg20|Schizosaccharomyces pombe|chr 3|||Manual Length = 534 Score = 26.2 bits (55), Expect = 3.1 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +2 Query: 401 SNKRPPHRLNRLRRTANTSSKPRYHSTDSETQXT 502 S+ +P H LN T P Y+S+ SE T Sbjct: 222 SDMQPTHELNESPSTPTAPDFPHYNSSPSELSPT 255 >SPAC26A3.15c |nsp1||nucleoporin Nsp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 598 Score = 25.4 bits (53), Expect = 5.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 468 DTTVRTQKHSXLGANTPADPLLIP 539 DTT T K L N PADP P Sbjct: 380 DTTTSTSKTGPLFGNKPADPSAKP 403 >SPBC947.12 |kms2||spindle pole body protein Kms2|Schizosaccharomyces pombe|chr 2|||Manual Length = 457 Score = 25.0 bits (52), Expect = 7.2 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -1 Query: 320 KCSLNSGGISSKGNLSKPLKLSQNR 246 K +L G+ + +++KP K+S+NR Sbjct: 90 KLALRENGVLPRKSVAKPQKISENR 114 >SPAC664.03 |||RNA polymerase II associated Paf1 complex |Schizosaccharomyces pombe|chr 1|||Manual Length = 457 Score = 25.0 bits (52), Expect = 7.2 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 441 AQRTRAANPDTTVRTQKHSXLGANTPADPL 530 A++T P+T + S AN+PA P+ Sbjct: 410 AEQTNGVKPETQAQNMSASESQANSPAPPV 439 >SPAC922.06 |||short chain dehydrogenase|Schizosaccharomyces pombe|chr 1|||Manual Length = 258 Score = 24.6 bits (51), Expect = 9.5 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 134 SGAWSELAARHPDIAARLRQ 193 S AW E +HPD+ R+++ Sbjct: 180 SPAWDERFKKHPDVGDRMKR 199 >SPBC18H10.06c |swd2|swd2.1|COMPASS complex subunit Swd2|Schizosaccharomyces pombe|chr 2|||Manual Length = 357 Score = 24.6 bits (51), Expect = 9.5 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 223 TLQQRRY*RFCDNFSGFDRFPFDDIPPEF 309 ++ +R+Y N FD PF DIP F Sbjct: 169 SVSERKYKISLYNIKSFDARPFQDIPLTF 197 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,622,816 Number of Sequences: 5004 Number of extensions: 23109 Number of successful extensions: 73 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 223909422 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -