BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30417 (407 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 1.8 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 4.1 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 4.1 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 20 9.4 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 20 9.4 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 20 9.4 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.6 bits (46), Expect = 1.8 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +2 Query: 125 LLESRLSPRSLVGANVMELHLHISA 199 LL++RL+P S + ++ H H+S+ Sbjct: 268 LLKARLNPNSSLQPSLASHHSHLSS 292 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.4 bits (43), Expect = 4.1 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -1 Query: 317 SVKVSSTLCGENATTVLNFLNSFNASNDCKALRA 216 SV+ SS +CG N + + N N C A Sbjct: 347 SVRDSSIICGGNKRSQVFRGRDANRQNSCNIYNA 380 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 4.1 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 15 AHGSCKDSSLQRAGSV 62 AHG ++ +LQ+AG V Sbjct: 427 AHGEDREEALQKAGIV 442 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 20.2 bits (40), Expect = 9.4 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +2 Query: 98 SFVIFTFAHLLESRLSPRSLVGANVME 178 +F+I +A LL +R + + ANV E Sbjct: 418 AFIILQYAGLLRNRSEYLNHLRANVAE 444 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 20.2 bits (40), Expect = 9.4 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -3 Query: 84 HIEPIRVIRSQLFEAS 37 H+E R+IR+ FE++ Sbjct: 383 HVEVARLIRNYYFESN 398 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 20.2 bits (40), Expect = 9.4 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -3 Query: 84 HIEPIRVIRSQLFEAS 37 H+E R+IR+ FE++ Sbjct: 383 HVEVARLIRNYYFESN 398 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,013 Number of Sequences: 438 Number of extensions: 2002 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10256061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -