BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30416 (738 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 24 5.6 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 24 5.6 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 24 5.6 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 9.8 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 23.8 bits (49), Expect = 5.6 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = +2 Query: 344 KHVR--RIRPNLKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 475 KHV+ + +LK +VC+ + +RVV GI SGL L +GP Sbjct: 109 KHVKFCQFAFDLKCDSVCV---NPYHYERVVSPGIDLSGLTLQSGP 151 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 23.8 bits (49), Expect = 5.6 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = +1 Query: 433 CWNSAQRSAFSYWTFCFQF-VPATP-YSQRYVIG 528 CW+ A++ + W+F F +P T Y +R + G Sbjct: 337 CWSRARKLVAAAWSFSILFSLPITYFYEERLIQG 370 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 23.8 bits (49), Expect = 5.6 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +3 Query: 402 LVDMQARGLYLLEFCPAVCF*LLDL-LLSIRARYAVFSALCDRHLHQN 542 ++DM+A + L + VC +++ L + AR V AL RH HQ+ Sbjct: 169 MLDMEA--VSLEQIAELVCENMVNSGTLPVEARDKVIDALLKRHKHQH 214 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.0 bits (47), Expect = 9.8 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -3 Query: 280 TFEGYCSGSPFFSP 239 +FEG C+ PF++P Sbjct: 82 SFEGDCNEKPFYAP 95 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 766,091 Number of Sequences: 2352 Number of extensions: 15631 Number of successful extensions: 27 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -