BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30415 (590 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g02590.1 68416.m00250 delta 7-sterol-C5-desaturase, putative ... 29 3.1 At3g02580.1 68416.m00249 delta 7-sterol-C5-desaturase (STE1) ide... 28 4.1 At2g19930.1 68415.m02329 RNA-dependent RNA polymerase family pro... 27 7.1 At5g44390.1 68418.m05435 FAD-binding domain-containing protein s... 27 9.4 >At3g02590.1 68416.m00250 delta 7-sterol-C5-desaturase, putative similar to delta7 sterol C-5 desaturase GI:5031219 from [Arabidopsis thaliana] Length = 279 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +1 Query: 1 NRSKLKYIIF*SCWRRRPNFISTFILIFWTS*SLYFNFTRIWYNFSYY 144 NR L +++ + W P+F+ T++ + LYF +W + YY Sbjct: 20 NRMVLSHLLPVNLWEPLPHFLQTWLRNYLAGNILYFISGFLWCFYIYY 67 >At3g02580.1 68416.m00249 delta 7-sterol-C5-desaturase (STE1) identical to sterol-C5-desaturase GB:AAD12944 GI:4234768 from [Arabidopsis thaliana] Length = 281 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +1 Query: 1 NRSKLKYIIF*SCWRRRPNFISTFILIFWTS*SLYFNFTRIWYNFSYY 144 NR L +++ + W P+F+ T++ + LYF +W + YY Sbjct: 19 NRIVLSHLLPANLWEPLPHFLQTWLRNYLAGTLLYFISGFLWCFYIYY 66 >At2g19930.1 68415.m02329 RNA-dependent RNA polymerase family protein contains Pfam domain, PF05183: RNA dependent RNA polymerase Length = 977 Score = 27.5 bits (58), Expect = 7.1 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 508 WEWAPTHKRYQCNVIPNG 455 W+ TH YQCNV PNG Sbjct: 197 WDSGKTHY-YQCNVAPNG 213 >At5g44390.1 68418.m05435 FAD-binding domain-containing protein similar to SP|P30986 reticuline oxidase precursor (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) [Eschscholzia californica]; contains PF01565 FAD binding domain Length = 542 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = -3 Query: 576 NKGDPVNKPPP---*LQILRPLGRAYGNGR 496 N G P N PPP LQ P+G+ Y G+ Sbjct: 356 NSGFPTNPPPPIEILLQAKSPIGKVYFKGK 385 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,138,245 Number of Sequences: 28952 Number of extensions: 225890 Number of successful extensions: 454 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 454 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1171109464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -