BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30414 (865 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g16110.1 68417.m02442 two-component responsive regulator fami... 29 5.3 At5g62150.1 68418.m07800 peptidoglycan-binding LysM domain-conta... 28 7.0 >At4g16110.1 68417.m02442 two-component responsive regulator family protein / response regulator family protein similar to ARR2 protein GI:4210451 from [Arabidopsis thaliana]; contains Pfam profile: PF00072 response regulator receiver domain Length = 644 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -3 Query: 713 SPFYTLLELGHVFLTPSSPKMLAYLFNPLITCEPGNRVF 597 SP L L HVF+ S ++ + +TC P N +F Sbjct: 589 SPSRNLYHLNHVFMDGGSVRVKSERVAETVTCPPANTLF 627 >At5g62150.1 68418.m07800 peptidoglycan-binding LysM domain-containing protein contains Pfam profile PF01476: LysM domain Length = 102 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 453 HSIGSD*GDP*LSTTNSFVSDPEDLTP 533 H+IG GDP + N + DP+D+ P Sbjct: 61 HTIGDKCGDPFIVERNPHIHDPDDVFP 87 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,964,356 Number of Sequences: 28952 Number of extensions: 416539 Number of successful extensions: 987 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 971 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 987 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2019160800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -