BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30411 (576 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0466 + 3649500-3649635,3649925-3650520 28 6.1 09_04_0517 - 18253325-18253870,18254209-18254781,18254888-182551... 28 6.1 >12_01_0466 + 3649500-3649635,3649925-3650520 Length = 243 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +2 Query: 179 LQAHFKGSSRRNHQFTNLFEMPSQLPWLNDPTGD 280 LQ H + +R T LFE+ QL +P GD Sbjct: 151 LQLHLRAEPKRGRPGTGLFELGLQLHLWAEPKGD 184 >09_04_0517 - 18253325-18253870,18254209-18254781,18254888-18255100, 18255554-18255685,18255804-18255944,18256104-18256325 Length = 608 Score = 27.9 bits (59), Expect = 6.1 Identities = 14/60 (23%), Positives = 26/60 (43%) Frame = +1 Query: 361 YIIVGNVTKAILSNEYVFE*VQSVPGHNPARSLSTYPIVCNIGSHEYLIVCFILYVIFYC 540 Y + + K + ++ FE V GH+ A+ + S EY+I+ + + F C Sbjct: 478 YGFIDTIRKCVGMSKMSFEVTAKVSGHDEAKRYEQEILEFGSSSPEYVIIATVALLNFVC 537 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,955,559 Number of Sequences: 37544 Number of extensions: 310314 Number of successful extensions: 783 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 763 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 783 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1340735508 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -