BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30411 (576 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM404259-1|CAL49295.1| 1200|Homo sapiens breast cancer anti-estr... 33 0.72 AM404183-1|CAL49297.1| 1200|Homo sapiens breast cancer anti-estr... 33 0.72 AM404182-1|CAL49296.1| 1220|Homo sapiens breast cancer anti-estr... 33 0.72 AL096814-3|CAD92528.2| 1117|Homo sapiens transcriptional regulat... 33 0.72 AL096814-2|CAD92527.2| 1129|Homo sapiens transcriptional regulat... 33 0.72 AL096814-1|CAD92526.1| 1200|Homo sapiens transcriptional regulat... 33 0.72 AJ277276-1|CAB88207.1| 968|Homo sapiens rapa-2 protein. 33 0.72 AJ277275-1|CAB88206.1| 956|Homo sapiens rapa-1 protein. 33 0.72 AF297872-1|AAL01653.1| 1200|Homo sapiens zinc finger transcripti... 33 0.72 U90545-1|AAB53423.1| 401|Homo sapiens sodium phosphate transpor... 29 8.9 BC017952-1|AAH17952.1| 420|Homo sapiens SLC17A3 protein protein. 29 8.9 AL138726-6|CAC16544.1| 222|Homo sapiens solute carrier family 1... 29 8.9 AL138726-5|CAC16543.1| 420|Homo sapiens solute carrier family 1... 29 8.9 >AM404259-1|CAL49295.1| 1200|Homo sapiens breast cancer anti-estrogen resistance 2 protein. Length = 1200 Score = 33.1 bits (72), Expect = 0.72 Identities = 21/53 (39%), Positives = 27/53 (50%) Frame = +1 Query: 193 QRKFPEKPSIYKLV*DAQSTTLVKRPHGRWPLLRSHDLEPHVLY*LILIWCSS 351 Q + PE I L D TLV +P WP L +HDL+ V L+ + CSS Sbjct: 788 QAEIPELQDISALAQDTHKATLVWKP---WPELENHDLQQRVEN-LLNLCCSS 836 >AM404183-1|CAL49297.1| 1200|Homo sapiens breast cancer anti-estrogen resistance 2 protein. Length = 1200 Score = 33.1 bits (72), Expect = 0.72 Identities = 21/53 (39%), Positives = 27/53 (50%) Frame = +1 Query: 193 QRKFPEKPSIYKLV*DAQSTTLVKRPHGRWPLLRSHDLEPHVLY*LILIWCSS 351 Q + PE I L D TLV +P WP L +HDL+ V L+ + CSS Sbjct: 788 QAEIPELQDISALAQDTHKATLVWKP---WPELENHDLQQRVEN-LLNLCCSS 836 >AM404182-1|CAL49296.1| 1220|Homo sapiens breast cancer anti-estrogen resistance 2 protein. Length = 1220 Score = 33.1 bits (72), Expect = 0.72 Identities = 21/53 (39%), Positives = 27/53 (50%) Frame = +1 Query: 193 QRKFPEKPSIYKLV*DAQSTTLVKRPHGRWPLLRSHDLEPHVLY*LILIWCSS 351 Q + PE I L D TLV +P WP L +HDL+ V L+ + CSS Sbjct: 808 QAEIPELQDISALAQDTHKATLVWKP---WPELENHDLQQRVEN-LLNLCCSS 856 >AL096814-3|CAD92528.2| 1117|Homo sapiens transcriptional regulating factor 1 protein. Length = 1117 Score = 33.1 bits (72), Expect = 0.72 Identities = 21/53 (39%), Positives = 27/53 (50%) Frame = +1 Query: 193 QRKFPEKPSIYKLV*DAQSTTLVKRPHGRWPLLRSHDLEPHVLY*LILIWCSS 351 Q + PE I L D TLV +P WP L +HDL+ V L+ + CSS Sbjct: 705 QAEIPELQDISALAQDTHKATLVWKP---WPELENHDLQQRVEN-LLNLCCSS 753 >AL096814-2|CAD92527.2| 1129|Homo sapiens transcriptional regulating factor 1 protein. Length = 1129 Score = 33.1 bits (72), Expect = 0.72 Identities = 21/53 (39%), Positives = 27/53 (50%) Frame = +1 Query: 193 QRKFPEKPSIYKLV*DAQSTTLVKRPHGRWPLLRSHDLEPHVLY*LILIWCSS 351 Q + PE I L D TLV +P WP L +HDL+ V L+ + CSS Sbjct: 705 QAEIPELQDISALAQDTHKATLVWKP---WPELENHDLQQRVEN-LLNLCCSS 753 >AL096814-1|CAD92526.1| 1200|Homo sapiens transcriptional regulating factor 1 protein. Length = 1200 Score = 33.1 bits (72), Expect = 0.72 Identities = 21/53 (39%), Positives = 27/53 (50%) Frame = +1 Query: 193 QRKFPEKPSIYKLV*DAQSTTLVKRPHGRWPLLRSHDLEPHVLY*LILIWCSS 351 Q + PE I L D TLV +P WP L +HDL+ V L+ + CSS Sbjct: 788 QAEIPELQDISALAQDTHKATLVWKP---WPELENHDLQQRVEN-LLNLCCSS 836 >AJ277276-1|CAB88207.1| 968|Homo sapiens rapa-2 protein. Length = 968 Score = 33.1 bits (72), Expect = 0.72 Identities = 21/53 (39%), Positives = 27/53 (50%) Frame = +1 Query: 193 QRKFPEKPSIYKLV*DAQSTTLVKRPHGRWPLLRSHDLEPHVLY*LILIWCSS 351 Q + PE I L D TLV +P WP L +HDL+ V L+ + CSS Sbjct: 544 QAEIPELQDISALAQDTHKATLVWKP---WPELENHDLQQRVEN-LLNLCCSS 592 >AJ277275-1|CAB88206.1| 956|Homo sapiens rapa-1 protein. Length = 956 Score = 33.1 bits (72), Expect = 0.72 Identities = 21/53 (39%), Positives = 27/53 (50%) Frame = +1 Query: 193 QRKFPEKPSIYKLV*DAQSTTLVKRPHGRWPLLRSHDLEPHVLY*LILIWCSS 351 Q + PE I L D TLV +P WP L +HDL+ V L+ + CSS Sbjct: 544 QAEIPELQDISALAQDTHKATLVWKP---WPELENHDLQQRVEN-LLNLCCSS 592 >AF297872-1|AAL01653.1| 1200|Homo sapiens zinc finger transcription factor TReP-132 protein. Length = 1200 Score = 33.1 bits (72), Expect = 0.72 Identities = 21/53 (39%), Positives = 27/53 (50%) Frame = +1 Query: 193 QRKFPEKPSIYKLV*DAQSTTLVKRPHGRWPLLRSHDLEPHVLY*LILIWCSS 351 Q + PE I L D TLV +P WP L +HDL+ V L+ + CSS Sbjct: 788 QAEIPELQDISALAQDTHKATLVWKP---WPELENHDLQQRVEN-LLNLCCSS 836 >U90545-1|AAB53423.1| 401|Homo sapiens sodium phosphate transporter protein. Length = 401 Score = 29.5 bits (63), Expect = 8.9 Identities = 18/70 (25%), Positives = 34/70 (48%) Frame = +1 Query: 340 WCSSCSKYIIVGNVTKAILSNEYVFE*VQSVPGHNPARSLSTYPIVCNIGSHEYLIVCFI 519 W S+ K I+ ++ + + S++ Q +P RSL + I SH++L+ + Sbjct: 164 WISTSEKEYIISSLKQQVGSSK------QPLPIKAMLRSLPIWSICLGCFSHQWLVSTMV 217 Query: 520 LYVIFYCKSV 549 +Y+ Y SV Sbjct: 218 VYIPTYISSV 227 >BC017952-1|AAH17952.1| 420|Homo sapiens SLC17A3 protein protein. Length = 420 Score = 29.5 bits (63), Expect = 8.9 Identities = 18/70 (25%), Positives = 34/70 (48%) Frame = +1 Query: 340 WCSSCSKYIIVGNVTKAILSNEYVFE*VQSVPGHNPARSLSTYPIVCNIGSHEYLIVCFI 519 W S+ K I+ ++ + + S++ Q +P RSL + I SH++L+ + Sbjct: 183 WISTSEKEYIISSLKQQVGSSK------QPLPIKAMLRSLPIWSICLGCFSHQWLVSTMV 236 Query: 520 LYVIFYCKSV 549 +Y+ Y SV Sbjct: 237 VYIPTYISSV 246 >AL138726-6|CAC16544.1| 222|Homo sapiens solute carrier family 17 (sodium phosphate), member 3 protein. Length = 222 Score = 29.5 bits (63), Expect = 8.9 Identities = 18/70 (25%), Positives = 34/70 (48%) Frame = +1 Query: 340 WCSSCSKYIIVGNVTKAILSNEYVFE*VQSVPGHNPARSLSTYPIVCNIGSHEYLIVCFI 519 W S+ K I+ ++ + + S++ Q +P RSL + I SH++L+ + Sbjct: 152 WISTSEKEYIISSLKQQVGSSK------QPLPIKAMLRSLPIWSICLGCFSHQWLVSTMV 205 Query: 520 LYVIFYCKSV 549 +Y+ Y SV Sbjct: 206 VYIPTYISSV 215 >AL138726-5|CAC16543.1| 420|Homo sapiens solute carrier family 17 (sodium phosphate), member 3 protein. Length = 420 Score = 29.5 bits (63), Expect = 8.9 Identities = 18/70 (25%), Positives = 34/70 (48%) Frame = +1 Query: 340 WCSSCSKYIIVGNVTKAILSNEYVFE*VQSVPGHNPARSLSTYPIVCNIGSHEYLIVCFI 519 W S+ K I+ ++ + + S++ Q +P RSL + I SH++L+ + Sbjct: 183 WISTSEKEYIISSLKQQVGSSK------QPLPIKAMLRSLPIWSICLGCFSHQWLVSTMV 236 Query: 520 LYVIFYCKSV 549 +Y+ Y SV Sbjct: 237 VYIPTYISSV 246 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,732,194 Number of Sequences: 237096 Number of extensions: 1828934 Number of successful extensions: 3849 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 3801 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3849 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5929224630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -