BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30407 (733 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 65 5e-11 At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-l... 64 1e-10 At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-l... 64 1e-10 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 62 3e-10 At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)... 53 2e-07 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 50 2e-06 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 50 2e-06 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 50 2e-06 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 50 2e-06 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 50 2e-06 At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein... 49 4e-06 At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly id... 48 6e-06 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 45 6e-05 At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p... 40 0.002 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 39 0.003 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 39 0.004 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 39 0.004 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 38 0.007 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 38 0.007 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 38 0.009 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 38 0.009 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 37 0.012 At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33... 37 0.012 At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RS... 37 0.016 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 36 0.021 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 36 0.021 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 36 0.021 At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 36 0.021 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 36 0.021 At2g47310.1 68415.m05906 flowering time control protein-related ... 36 0.021 At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RS... 36 0.028 At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RS... 36 0.028 At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL3... 36 0.028 At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing ... 36 0.037 At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RS... 36 0.037 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 36 0.037 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 36 0.037 At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing ... 35 0.048 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 35 0.048 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 35 0.048 At5g12190.1 68418.m01430 RNA recognition motif (RRM)-containing ... 35 0.064 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 35 0.064 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 35 0.064 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 34 0.085 At1g29400.2 68414.m03597 RNA recognition motif (RRM)-containing ... 34 0.085 At1g29400.1 68414.m03596 RNA recognition motif (RRM)-containing ... 34 0.085 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 34 0.11 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 34 0.11 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 34 0.11 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 33 0.15 At1g43190.1 68414.m04977 polypyrimidine tract-binding protein, p... 33 0.15 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 33 0.20 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 33 0.20 At4g18120.1 68417.m02694 RNA recognition motif (RRM)-containing ... 33 0.26 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 33 0.26 At1g06960.2 68414.m00741 small nuclear ribonucleoprotein U2B, pu... 33 0.26 At1g06960.1 68414.m00740 small nuclear ribonucleoprotein U2B, pu... 33 0.26 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 32 0.34 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 32 0.34 At5g51120.1 68418.m06339 polyadenylate-binding protein, putative... 32 0.45 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 32 0.45 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 32 0.45 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 32 0.45 At4g10110.1 68417.m01654 RNA recognition motif (RRM)-containing ... 32 0.45 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 32 0.45 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 32 0.45 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 31 0.60 At2g47580.1 68415.m05937 small nuclear ribonucleoprotein U1A / s... 31 0.60 At2g30260.1 68415.m03684 small nuclear ribonucleoprotein U2B, pu... 31 0.60 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 31 0.60 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 31 0.79 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 31 0.79 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 31 0.79 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 31 0.79 At5g43960.2 68418.m05378 nuclear transport factor 2 (NTF2) famil... 31 1.0 At5g43960.1 68418.m05379 nuclear transport factor 2 (NTF2) famil... 31 1.0 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 31 1.0 At4g25500.2 68417.m03674 arginine/serine-rich splicing factor RS... 31 1.0 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 31 1.0 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 31 1.0 At5g44200.1 68418.m05408 nuclear cap-binding protein, putative s... 30 1.4 At5g10350.2 68418.m01201 polyadenylate-binding protein family pr... 30 1.4 At5g10350.1 68418.m01200 polyadenylate-binding protein family pr... 30 1.4 At2g42890.2 68415.m05312 RNA recognition motif (RRM)-containing ... 30 1.4 At2g42890.1 68415.m05311 RNA recognition motif (RRM)-containing ... 30 1.4 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 30 1.8 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 30 1.8 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 30 1.8 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 30 1.8 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 30 1.8 At5g58130.1 68418.m07273 RNA recognition motif (RRM)-containing ... 29 2.4 At3g21215.1 68416.m02681 RNA-binding protein, putative contains ... 29 2.4 At3g13700.1 68416.m01731 RNA-binding protein, putative similar t... 29 2.4 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 29 2.4 At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing ... 29 3.2 At5g16300.1 68418.m01905 expressed protein 29 3.2 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 29 3.2 At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing ... 29 3.2 At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing ... 29 4.2 At5g12080.2 68418.m01415 mechanosensitive ion channel domain-con... 29 4.2 At5g12080.1 68418.m01414 mechanosensitive ion channel domain-con... 29 4.2 At5g03580.1 68418.m00316 polyadenylate-binding protein, putative... 29 4.2 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 29 4.2 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 28 5.6 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 28 5.6 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 28 7.3 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 28 7.3 At3g16090.1 68416.m02033 zinc finger (C3HC4-type RING finger) fa... 28 7.3 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 28 7.3 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 28 7.3 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 28 7.3 At5g16300.2 68418.m01906 expressed protein 27 9.7 At1g71930.1 68414.m08315 no apical meristem (NAM) family protein... 27 9.7 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 27 9.7 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 64.9 bits (151), Expect = 5e-11 Identities = 26/47 (55%), Positives = 36/47 (76%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFEDPR 254 +VYVGNL ++ E+E F +G +R+VWVAR PPG+AF++FEDPR Sbjct: 3 RVYVGNLDPRVTERELEDEFRAFGVVRSVWVARRPPGYAFLDFEDPR 49 >At1g23860.2 68414.m03010 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 63.7 bits (148), Expect = 1e-10 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFEDPR 254 +VYVGNL ++ E+E F +G +RNVWVAR PPG+AF+EF+D R Sbjct: 3 RVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLEFDDER 49 >At1g23860.1 68414.m03009 splicing factor RSZp21 (RSZP21) / 9G8-like SR protein (SRZ21) nearly identical to 9G8-like splicing factor SRZ21 [Arabidopsis thaliana] GI:3435096, RSZp21 protein [Arabidopsis thaliana] GI:2582643 Length = 187 Score = 63.7 bits (148), Expect = 1e-10 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFEDPR 254 +VYVGNL ++ E+E F +G +RNVWVAR PPG+AF+EF+D R Sbjct: 3 RVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLEFDDER 49 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 62.5 bits (145), Expect = 3e-10 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFEDPR 254 +VYVGNL ++ E+E F +G IR+VWVAR PPG+AF++FED R Sbjct: 3 RVYVGNLDPRVTERELEDEFRSFGVIRSVWVARRPPGYAFLDFEDSR 49 >At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30) nearly identical to SF2/ASF-like splicing modulator Srp30 [Arabidopsis thaliana] GI:4775270 Length = 268 Score = 53.2 bits (122), Expect = 2e-07 Identities = 25/48 (52%), Positives = 33/48 (68%), Gaps = 2/48 (4%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNV--WVARNPPGFAFVEFEDPR 254 +YVGNL + K E+E +F KYG I ++ + PPG+AFVEFEDPR Sbjct: 9 IYVGNLPGDIRKCEVEDLFYKYGPIVDIDLKIPPRPPGYAFVEFEDPR 56 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +2 Query: 248 PPYAEDSVRGLDGTRCCGTRIRVEMSNGRTR 340 P A+D++ G DG G R+RVE+++G R Sbjct: 55 PRDADDAIYGRDGYDFDGCRLRVEIAHGGRR 85 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/48 (47%), Positives = 32/48 (66%), Gaps = 2/48 (4%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNV--WVARNPPGFAFVEFEDPR 254 +YVGNL + + E+E +FSKYG + + + PPG+AFVEFED R Sbjct: 9 IYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRPPGYAFVEFEDAR 56 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/48 (47%), Positives = 32/48 (66%), Gaps = 2/48 (4%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNV--WVARNPPGFAFVEFEDPR 254 +YVGNL + + E+E +FSKYG + + + PPG+AFVEFED R Sbjct: 9 IYVGNLPGDIREREVEDLFSKYGPVVQIDLKIPPRPPGYAFVEFEDAR 56 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/48 (50%), Positives = 32/48 (66%), Gaps = 2/48 (4%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNV--WVARNPPGFAFVEFEDPR 254 VYVGNL + + E+E +FSKYG + + V PPG+AFVEF+D R Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDAR 56 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 257 AEDSVRGLDGTRCCGTRIRVEMSNGRTR 340 AED++ G DG G R+RVE+++G R Sbjct: 58 AEDAIHGRDGYDFDGHRLRVELAHGGRR 85 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/48 (50%), Positives = 32/48 (66%), Gaps = 2/48 (4%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNV--WVARNPPGFAFVEFEDPR 254 VYVGNL + + E+E +FSKYG + + V PPG+AFVEF+D R Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDAR 56 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 257 AEDSVRGLDGTRCCGTRIRVEMSNGRTR 340 AED++ G DG G R+RVE+++G R Sbjct: 58 AEDAIHGRDGYDFDGHRLRVELAHGGRR 85 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/48 (50%), Positives = 32/48 (66%), Gaps = 2/48 (4%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNV--WVARNPPGFAFVEFEDPR 254 VYVGNL + + E+E +FSKYG + + V PPG+AFVEF+D R Sbjct: 9 VYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDAR 56 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 257 AEDSVRGLDGTRCCGTRIRVEMSNGRTR 340 AED++ G DG G R+RVE+++G R Sbjct: 58 AEDAIHGRDGYDFDGHRLRVELAHGGRR 85 >At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 284 Score = 48.8 bits (111), Expect = 4e-06 Identities = 23/58 (39%), Positives = 38/58 (65%) Frame = +3 Query: 81 MSRYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFEDPR 254 M RY + + ++YVG L + ++E++FS+YG +R+V + R+ +AFVEF DPR Sbjct: 1 MPRYDDRYGNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRD---YAFVEFSDPR 55 >At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 290 Score = 48.0 bits (109), Expect = 6e-06 Identities = 23/58 (39%), Positives = 38/58 (65%) Frame = +3 Query: 81 MSRYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFEDPR 254 M RY + + ++YVG L + ++E++FS+YG +R+V + R+ +AFVEF DPR Sbjct: 1 MPRYDDRYGNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRD---YAFVEFGDPR 55 >At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 300 Score = 44.8 bits (101), Expect = 6e-05 Identities = 24/51 (47%), Positives = 31/51 (60%), Gaps = 2/51 (3%) Frame = +3 Query: 108 SCKVYVGNLGTNASKYEIEKIFSKYGNIRNV--WVARNPPGFAFVEFEDPR 254 S +YVGNL + ++EIE IF KYG I ++ V PP + FVEFE R Sbjct: 6 SRSIYVGNLPGDIREHEIEDIFYKYGRIVDIELKVPPRPPCYCFVEFEHSR 56 Score = 31.5 bits (68), Expect = 0.60 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 3/35 (8%) Frame = +2 Query: 257 AEDSVRGLDGTRCCGTRIRVEMSN---GRTRRDRR 352 AED+++G DG G R+RVE+++ G++ DRR Sbjct: 58 AEDAIKGRDGYNLDGCRLRVELAHGGRGQSSSDRR 92 >At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 250 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/46 (41%), Positives = 29/46 (63%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFEDPR 254 VYVGN + ++E++FSK+G ++ V + G+AFV FED R Sbjct: 4 VYVGNFDYDTRHSDLERLFSKFGRVKRVDM---KSGYAFVYFEDER 46 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 5/52 (9%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDPRM 257 +Y+G + + EIE FS++G ++ V VARN F F++FEDP + Sbjct: 62 LYIGRIPHGFYETEIEAFFSQFGTVKRVRVARNKKTGKSKHFGFIQFEDPEV 113 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/51 (37%), Positives = 32/51 (62%), Gaps = 4/51 (7%) Frame = +3 Query: 105 LSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVAR----NPPGFAFVEFE 245 L K++VG L N S+ E++ +FSKYG I+++ + R G AF+++E Sbjct: 104 LEHKLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSKGCAFLKYE 154 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/51 (37%), Positives = 32/51 (62%), Gaps = 4/51 (7%) Frame = +3 Query: 105 LSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVAR----NPPGFAFVEFE 245 L K++VG L N S+ E++ +FSKYG I+++ + R G AF+++E Sbjct: 104 LEHKLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSKGCAFLKYE 154 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 37.9 bits (84), Expect = 0.007 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 5/65 (7%) Frame = +3 Query: 102 DLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNP-----PGFAFVEFEDPRMLKT 266 D KVYVGNL +K +E +FS+ G + + V+R P GF FV F ++ Sbjct: 174 DSPYKVYVGNLAKTVTKEMLENLFSEKGKVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEA 233 Query: 267 LFVDL 281 V L Sbjct: 234 AIVAL 238 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 37.9 bits (84), Expect = 0.007 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 4/47 (8%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNP----PGFAFVEF 242 ++YVGNL N S+ ++ K+F +G++ V V R+ GF FV+F Sbjct: 286 RLYVGNLHINMSEDDLRKVFESFGSVELVQVPRDETGLCKGFGFVQF 332 Score = 30.3 bits (65), Expect = 1.4 Identities = 10/33 (30%), Positives = 23/33 (69%) Frame = +3 Query: 150 KYEIEKIFSKYGNIRNVWVARNPPGFAFVEFED 248 K ++++ SK+G + +++V +N GF ++ FE+ Sbjct: 488 KEDVKEECSKFGKLNHIFVDKNSVGFVYLRFEN 520 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 37.5 bits (83), Expect = 0.009 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 5/61 (8%) Frame = +3 Query: 87 RYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIR--NVWVARN---PPGFAFVEFEDP 251 R + +L +++VG L + ++ ++E F +YG I + V R+ P GF F+ F D Sbjct: 4 RENDGNLESRIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTDR 63 Query: 252 R 254 R Sbjct: 64 R 64 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 37.5 bits (83), Expect = 0.009 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 5/61 (8%) Frame = +3 Query: 87 RYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIR--NVWVARN---PPGFAFVEFEDP 251 R + +L +++VG L + ++ ++E F +YG I + V R+ P GF F+ F D Sbjct: 4 RENDGNLESRIFVGGLSWDVTERQLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTDR 63 Query: 252 R 254 R Sbjct: 64 R 64 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 37.1 bits (82), Expect = 0.012 Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 5/64 (7%) Frame = +3 Query: 102 DLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDPRMLKT 266 D C ++VG L + ++ + ++ SKYG I+N+ + R+ G+ FVE+E + + Sbjct: 61 DPYCTLFVGRLSHHTTEDTLREVMSKYGRIKNLRLVRHIVTGASRGYGFVEYETEKEMLR 120 Query: 267 LFVD 278 + D Sbjct: 121 AYED 124 >At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33) nearly identical to SC35-like splicing factor SCL33, 33 kD [Arabidopsis thaliana] GI:9843659 Length = 220 Score = 37.1 bits (82), Expect = 0.012 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 5/58 (8%) Frame = +3 Query: 93 REWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDP 251 R DL + V NL + + ++ K F ++G ++++++ R+ P GF FV+F DP Sbjct: 30 RSRDLPTSLLVRNLRHDCRQEDLRKSFEQFGPVKDIYLPRDYYTGDPRGFGFVQFMDP 87 >At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RSP31 (RSP31) identical to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 264 Score = 36.7 bits (81), Expect = 0.016 Identities = 18/46 (39%), Positives = 27/46 (58%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFEDPR 254 V+VGN + ++E++F KYG + V + G+AFV FED R Sbjct: 4 VFVGNFEYETRQSDLERLFDKYGRVDRVDM---KSGYAFVYFEDER 46 Score = 32.7 bits (71), Expect = 0.26 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +3 Query: 150 KYEIEKIFSKYGNIRNVWVARNPPGFAFVEFE 245 +++IEK F YG + NV + RN F+FV+FE Sbjct: 107 EHDIEKHFEPYGKVTNVRIRRN---FSFVQFE 135 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 36.3 bits (80), Expect = 0.021 Identities = 15/43 (34%), Positives = 30/43 (69%) Frame = +3 Query: 87 RYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN 215 R R L K++VG+L A++ E+E+IF ++G++ +V++ R+ Sbjct: 203 RERIGTLEFKLFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRD 245 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 36.3 bits (80), Expect = 0.021 Identities = 15/43 (34%), Positives = 30/43 (69%) Frame = +3 Query: 87 RYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN 215 R R L K++VG+L A++ E+E+IF ++G++ +V++ R+ Sbjct: 203 RERIGTLEFKLFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRD 245 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 36.3 bits (80), Expect = 0.021 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 5/82 (6%) Frame = +3 Query: 69 IKTKMSRYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAF 233 I + S + ++ S VYVG + + ++ ++ +FS+YG I +V + R+ GFAF Sbjct: 22 ISDEASWHAKYKNSAYVYVGGIPFDLTEGDLLAVFSQYGEIVDVNLIRDKGTGKSKGFAF 81 Query: 234 VEFEDPRMLKTLFVDLMEHAAV 299 + +ED R L VD + A V Sbjct: 82 LAYEDQRS-TILAVDNLNGALV 102 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 36.3 bits (80), Expect = 0.021 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 5/60 (8%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDPRMLKTLFVD 278 K+++G L + + K F KYG I + + R+ P GF F+ F DP ++ + D Sbjct: 20 KIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIED 79 Score = 32.7 bits (71), Expect = 0.26 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 5/57 (8%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDPRMLKTL 269 K++VG + + ++ E++ F+KYGN+ V R+ GF FV F+ ++ L Sbjct: 110 KIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDEL 166 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 36.3 bits (80), Expect = 0.021 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 5/60 (8%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDPRMLKTLFVD 278 K+++G L + + K F KYG I + + R+ P GF F+ F DP ++ + D Sbjct: 20 KIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIED 79 Score = 32.7 bits (71), Expect = 0.26 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 5/57 (8%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDPRMLKTL 269 K++VG + + ++ E++ F+KYGN+ V R+ GF FV F+ ++ L Sbjct: 110 KIFVGGIPSTVTEDELKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDEL 166 >At2g47310.1 68415.m05906 flowering time control protein-related / FCA gamma-related Length = 512 Score = 36.3 bits (80), Expect = 0.021 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 4/52 (7%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNP----PGFAFVEFEDPRM 257 K+YV L +K E+ ++FS+YG I ++++A + G+AFV+F M Sbjct: 208 KLYVRCLNKQTTKMEVNEVFSRYGIIEDIYMALDDMKICRGYAFVQFSCKEM 259 Score = 33.9 bits (74), Expect = 0.11 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNV 200 K+YV + A++Y+I ++F KYGN+ + Sbjct: 111 KLYVAPISKTATEYDIRQVFEKYGNVTEI 139 >At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 357 Score = 35.9 bits (79), Expect = 0.028 Identities = 18/46 (39%), Positives = 27/46 (58%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFEDPR 254 V+ GN +A + ++E++F KYG + V + GFAFV ED R Sbjct: 4 VFCGNFEYDARESDLERLFRKYGKVERVDM---KAGFAFVYMEDER 46 >At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 356 Score = 35.9 bits (79), Expect = 0.028 Identities = 18/46 (39%), Positives = 27/46 (58%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFEDPR 254 V+ GN +A + ++E++F KYG + V + GFAFV ED R Sbjct: 4 VFCGNFEYDARESDLERLFRKYGKVERVDM---KAGFAFVYMEDER 46 >At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL30a) almost identical to SC35-like splicing factor SCL30a GI:9843661 from [Arabidopsis thaliana]; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 35.9 bits (79), Expect = 0.028 Identities = 16/58 (27%), Positives = 34/58 (58%), Gaps = 5/58 (8%) Frame = +3 Query: 93 REWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDP 251 R+ DL + V NL + + ++ + F ++G ++++++ R+ P GF F++F DP Sbjct: 31 RDSDLPTSLLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPRDYYTGDPRGFGFIQFMDP 88 >At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing protein Mei2-like protein - Arabidopsis thaliana, EMBL:D86122 Length = 907 Score = 35.5 bits (78), Expect = 0.037 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFEDPRMLK 263 ++V NL ++ S E+ IFS YG IR V + ++EF D R K Sbjct: 297 LWVNNLDSSISNEELHGIFSSYGEIREVRRTMHENSQVYIEFFDVRKAK 345 >At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RSP40 (RSP40) identical to SP|P92965 Arginine/serine-rich splicing factor RSP40 {Arabidopsis thaliana} Length = 350 Score = 35.5 bits (78), Expect = 0.037 Identities = 18/46 (39%), Positives = 27/46 (58%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFEDPR 254 V+ GN +A + ++E++F KYG + V + GFAFV ED R Sbjct: 4 VFCGNFEYDAREGDLERLFRKYGKVERVDM---KAGFAFVYMEDER 46 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 Query: 141 NASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFE 245 N ++EK F YG I NV + RN FAF+++E Sbjct: 108 NTRTRDLEKHFEPYGKIVNVRIRRN---FAFIQYE 139 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 35.5 bits (78), Expect = 0.037 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 5/60 (8%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDPRMLKTLFVD 278 K+++G + + + + + FS +G + V V R P GF FV F DP ++ + D Sbjct: 7 KLFIGGISWDTDENLLREYFSNFGEVLQVTVMREKATGRPRGFGFVAFSDPAVIDRVLQD 66 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 35.5 bits (78), Expect = 0.037 Identities = 17/49 (34%), Positives = 30/49 (61%), Gaps = 4/49 (8%) Frame = +3 Query: 78 KMSRYREWDLSC----KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVAR 212 ++ R D SC K++VG L N S+ E++ +FS+YG I+++ + R Sbjct: 94 ELERLDVLDCSCNPEHKLFVGMLPKNVSETEVQSLFSEYGTIKDLQILR 142 >At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, EMBL:D86122 Length = 915 Score = 35.1 bits (77), Expect = 0.048 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = +3 Query: 123 VGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFEDPR 254 VGN+ +N YE++ +F ++G+I+ + A GF V + D R Sbjct: 221 VGNISSNVEDYELKVLFEQFGDIQALHTACKNRGFIMVSYCDIR 264 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/44 (25%), Positives = 22/44 (50%) Frame = +3 Query: 123 VGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFEDPR 254 V NL ++ S E+ ++ YG ++ + + ++EF D R Sbjct: 306 VNNLDSSISNQELNRLVKSYGEVKEIRRTMHDNSQIYIEFFDVR 349 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 35.1 bits (77), Expect = 0.048 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 4/71 (5%) Frame = +3 Query: 51 FYPPFSIKTKMSRYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPG-- 224 F PF K + + VYV NL + E++ F +YG+I + V R+ G Sbjct: 205 FVGPFLRKEERESAADKMKFTNVYVKNLSEATTDDELKTTFGQYGSISSAVVMRDGDGKS 264 Query: 225 --FAFVEFEDP 251 F FV FE+P Sbjct: 265 RCFGFVNFENP 275 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPG 224 +YV NL + ++ ++F+++G I + V R+P G Sbjct: 330 LYVKNLDDTVTDEKLRELFAEFGTITSCKVMRDPSG 365 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 35.1 bits (77), Expect = 0.048 Identities = 14/36 (38%), Positives = 25/36 (69%) Frame = +3 Query: 105 LSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVAR 212 L K++VG L N S+ E++ +FS+YG I+++ + R Sbjct: 98 LEHKLFVGMLPKNVSETEVQSLFSEYGTIKDLQILR 133 >At5g12190.1 68418.m01430 RNA recognition motif (RRM)-containing protein similar to SP|P52298 20 kDa nuclear cap binding protein (NCBP 20 kDa subunit) (CBP20) (NCBP interacting protein 1) (NIP1) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 124 Score = 34.7 bits (76), Expect = 0.064 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVA--RNPPGFAFVEFED 248 +YV NL N + E+ IF KYG IR + + + G AFV +ED Sbjct: 21 LYVRNLPFNITSEEMYDIFGKYGAIRQIRIGCDKATKGTAFVVYED 66 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 34.7 bits (76), Expect = 0.064 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 5/48 (10%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNP-----PGFAFVEF 242 K+YVGNL N S+ ++ +IF +G + V + +P GF F++F Sbjct: 266 KLYVGNLHFNMSELQLRQIFEAFGPVELVQLPLDPETGQCKGFGFIQF 313 Score = 28.7 bits (61), Expect = 4.2 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = +3 Query: 174 SKYGNIRNVWVARNPPGFAFVEFE 245 SKYG + +++V +N GF ++ F+ Sbjct: 466 SKYGPVNHIYVDKNSAGFVYLRFQ 489 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 34.7 bits (76), Expect = 0.064 Identities = 18/62 (29%), Positives = 35/62 (56%), Gaps = 4/62 (6%) Frame = +3 Query: 78 KMSRYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPP----GFAFVEFE 245 +++R+ E +Y+ NL + +++++FS+YGN+ + V NP GF FV + Sbjct: 322 RINRF-EKSQGANLYLKNLDDSVDDEKLKEMFSEYGNVTSSKVMLNPQGMSRGFGFVAYS 380 Query: 246 DP 251 +P Sbjct: 381 NP 382 Score = 31.9 bits (69), Expect = 0.45 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPG----FAFVEFE 245 VYV NL + E+ K F K+G I + V R+ G F FV FE Sbjct: 231 VYVKNLPKEIGEDELRKTFGKFGVISSAVVMRDQSGNSRCFGFVNFE 277 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 34.3 bits (75), Expect = 0.085 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 5/64 (7%) Frame = +3 Query: 102 DLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDPRMLKT 266 D + K++VG L + E K F KYG I + + ++ P GF FV + D ++ Sbjct: 39 DSAGKIFVGGLARETTSAEFLKHFGKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDK 98 Query: 267 LFVD 278 + D Sbjct: 99 VIQD 102 >At1g29400.2 68414.m03597 RNA recognition motif (RRM)-containing protein similar to GI:6650523 from [Arabidopsis thaliana] Length = 800 Score = 34.3 bits (75), Expect = 0.085 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFEDPR 254 ++V N+ +N E+ +F +YG+IR ++ GF + + D R Sbjct: 170 LFVRNINSNVEDSELTALFEQYGDIRTLYTTCKHRGFVMISYYDIR 215 >At1g29400.1 68414.m03596 RNA recognition motif (RRM)-containing protein similar to GI:6650523 from [Arabidopsis thaliana] Length = 800 Score = 34.3 bits (75), Expect = 0.085 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFEDPR 254 ++V N+ +N E+ +F +YG+IR ++ GF + + D R Sbjct: 170 LFVRNINSNVEDSELTALFEQYGDIRTLYTTCKHRGFVMISYYDIR 215 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 33.9 bits (74), Expect = 0.11 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 5/54 (9%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDPRML 260 K++VG + + ++ + F+ YG + V R+ P GF FV F DP +L Sbjct: 7 KLFVGGISWETDEDKLREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVL 60 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 33.9 bits (74), Expect = 0.11 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 5/47 (10%) Frame = +3 Query: 123 VGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFED 248 V N+ + E+ + F ++G +R+V++ R+ P GFAFVEF D Sbjct: 51 VRNIPLDCRPEELREPFERFGPVRDVYIPRDYYSGQPRGFAFVEFVD 97 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 33.9 bits (74), Expect = 0.11 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPG----FAFVEFEDP 251 VYV NL + E++K F KYG+I + V ++ G F FV F P Sbjct: 227 VYVKNLPKEITDDELKKTFGKYGDISSAVVMKDQSGNSRSFGFVNFVSP 275 Score = 33.5 bits (73), Expect = 0.15 Identities = 18/62 (29%), Positives = 36/62 (58%), Gaps = 4/62 (6%) Frame = +3 Query: 78 KMSRYREWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPP----GFAFVEFE 245 ++SR+ + S +Y+ NL + + +++++FS+YGN+ + V N GF FV + Sbjct: 318 RISRFEKLQGS-NLYLKNLDDSVNDEKLKEMFSEYGNVTSCKVMMNSQGLSRGFGFVAYS 376 Query: 246 DP 251 +P Sbjct: 377 NP 378 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 33.5 bits (73), Expect = 0.15 Identities = 14/60 (23%), Positives = 32/60 (53%), Gaps = 5/60 (8%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDPRMLKTLFVD 278 K+++G + + + +++ F KYG++ + R+ GF F+ F DP + + + +D Sbjct: 16 KLFIGGISWDTDEERLQEYFGKYGDLVEAVIMRDRTTGRARGFGFIVFADPSVAERVIMD 75 >At1g43190.1 68414.m04977 polypyrimidine tract-binding protein, putative / heterogeneous nuclear ribonucleoprotein, putative similar to Polypyrimidine tract-binding protein 1 (PTB) (Heterogeneous nuclear ribonucleoprotein I) (hnRNP I) from {Rattus norvegicus} SP|Q00438, {Homo sapiens} SP|P26599, [Homo sapiens] GI:35770; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 432 Score = 33.5 bits (73), Expect = 0.15 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 111 CKVYVGNLGTNA-SKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFED 248 C V V NL ++ + ++ +FS YGNI + + RN P A V+ D Sbjct: 245 CTVLVSNLNADSIDEDKLFNLFSLYGNIVRIKLLRNKPDHALVQMGD 291 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 33.1 bits (72), Expect = 0.20 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 5/61 (8%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNP-----PGFAFVEFEDPRMLKTLFVD 278 +++VG+L AS+ +++K+F G + V + +NP G AF+ F K + Sbjct: 215 EIFVGSLDKGASEEDLKKVFGHVGEVTEVRILKNPQTKKSKGSAFLRFATVEQAKRAVKE 274 Query: 279 L 281 L Sbjct: 275 L 275 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 33.1 bits (72), Expect = 0.20 Identities = 17/45 (37%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = +3 Query: 111 CK-VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEF 242 CK ++VG +G N SK ++E+ FSK+G I + R AF+++ Sbjct: 249 CKSLWVGGIGPNVSKDDLEEEFSKFGKIEDFRFLRERK-TAFIDY 292 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/45 (28%), Positives = 28/45 (62%) Frame = +3 Query: 108 SCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEF 242 S ++VG+L ++ ++ ++F +YG+I + V + GFAF+ + Sbjct: 17 SNNLWVGSLTPETTESDLTELFGRYGDIDRITV-YSSRGFAFIYY 60 >At4g18120.1 68417.m02694 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, gb:D86122 Length = 785 Score = 32.7 bits (71), Expect = 0.26 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +3 Query: 123 VGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFEDPR 254 V NL + S ++E IF YG I+ + N FVEF D R Sbjct: 226 VFNLAPSVSNRDLENIFGVYGEIKEIRETPNKRHHKFVEFFDVR 269 Score = 28.3 bits (60), Expect = 5.6 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = -1 Query: 298 TAACSIKSTNRVFSIRGSSNSTNANPGGFRATHTLRMLPYLENIFSISYLD 146 +A ++K+ NR ++ PGG R L+M P LE S SYL+ Sbjct: 270 SADAALKALNRTEIAGKRIKLEHSRPGGARRNMMLQMNPELEQDDSYSYLN 320 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 32.7 bits (71), Expect = 0.26 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 6/58 (10%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVAR-----NPPGFAFVEF-EDPRMLKTL 269 K++VG + S+ +++ FS+YG + VA+ P GF FV F D ++K L Sbjct: 7 KLFVGGIAKETSEEALKQYFSRYGAVLEAVVAKEKVTGKPRGFGFVRFANDCDVVKAL 64 >At1g06960.2 68414.m00741 small nuclear ribonucleoprotein U2B, putative / spliceosomal protein, putative non-consensus splice donor GC at exon 4; similar to spliceosomal protein (U2B) GI:169588 from [Solanum tuberosum] Length = 228 Score = 32.7 bits (71), Expect = 0.26 Identities = 12/44 (27%), Positives = 24/44 (54%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFED 248 +++ NL + ++ +F +Y + + + PG AFVE+ED Sbjct: 156 LFIHNLPIETNSMMLQLLFEQYPGFKEIRMIEAKPGIAFVEYED 199 >At1g06960.1 68414.m00740 small nuclear ribonucleoprotein U2B, putative / spliceosomal protein, putative non-consensus splice donor GC at exon 4; similar to spliceosomal protein (U2B) GI:169588 from [Solanum tuberosum] Length = 229 Score = 32.7 bits (71), Expect = 0.26 Identities = 12/44 (27%), Positives = 24/44 (54%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFED 248 +++ NL + ++ +F +Y + + + PG AFVE+ED Sbjct: 157 LFIHNLPIETNSMMLQLLFEQYPGFKEIRMIEAKPGIAFVEYED 200 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 32.3 bits (70), Expect = 0.34 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 5/57 (8%) Frame = +3 Query: 93 REWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFED 248 R +D + ++YVGNL + +E++FS++G + + V + GF FV+ + Sbjct: 201 RVYDAAFRIYVGNLPWDVDSGRLERLFSEHGKVVDARVVSDRETGRSRGFGFVQMSN 257 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 32.3 bits (70), Expect = 0.34 Identities = 29/99 (29%), Positives = 45/99 (45%), Gaps = 8/99 (8%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRN--VWVARN--PPGFAFVEFEDPRMLKTLFVDLM 284 +YV NL + ++E++FS++G I + V V N G FVEF + + Sbjct: 225 LYVKNLDDSVDNTKLEELFSEFGTITSCKVMVHSNGISKGVGFVEFSTSEEASKAMLKMN 284 Query: 285 -EHAAVAPGFVSKCQMVAQGE--TAGHFFNKPPT-HQRP 389 + P +VS Q Q + F N PP+ HQ+P Sbjct: 285 GKMVGNKPIYVSLAQCKEQHKLHLQTQFNNPPPSPHQQP 323 >At5g51120.1 68418.m06339 polyadenylate-binding protein, putative / PABP, putative contains similarity to poly(A)-binding protein II [Mus musculus] GI:2351846; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 227 Score = 31.9 bits (69), Expect = 0.45 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = +3 Query: 108 SCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN----PPGFAFVEF 242 S +YVGN+ + E+++ F G + V + + P GFA+VEF Sbjct: 102 SRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGFAYVEF 150 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 31.9 bits (69), Expect = 0.45 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 5/66 (7%) Frame = +3 Query: 108 SCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDPRMLKTLF 272 SCK+++G + S+ + F +G + + ++ GF FV F DP + + Sbjct: 5 SCKLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAER-- 62 Query: 273 VDLMEH 290 V L++H Sbjct: 63 VVLLKH 68 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 31.9 bits (69), Expect = 0.45 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 5/66 (7%) Frame = +3 Query: 108 SCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDPRMLKTLF 272 SCK+++G + S+ + F +G + + ++ GF FV F DP + + Sbjct: 5 SCKLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAER-- 62 Query: 273 VDLMEH 290 V L++H Sbjct: 63 VVLLKH 68 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 31.9 bits (69), Expect = 0.45 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 4/52 (7%) Frame = +3 Query: 108 SCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNP----PGFAFVEFEDP 251 S +YV NL + S ++++IFS +G + + V R+P G FV F P Sbjct: 131 SSNLYVKNLDPSISDEKLKEIFSPFGTVTSSKVMRDPNGTSKGSGFVAFATP 182 Score = 30.7 bits (66), Expect = 1.0 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN----PPGFAFVEFED 248 VYV NL + + +++ F +YG I + V ++ GF FV FE+ Sbjct: 31 VYVKNLAESTTDDDLKNAFGEYGKITSAVVMKDGEGKSKGFGFVNFEN 78 >At4g10110.1 68417.m01654 RNA recognition motif (RRM)-containing protein contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 173 Score = 31.9 bits (69), Expect = 0.45 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 5/51 (9%) Frame = +3 Query: 108 SCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFE 245 +C VY+GN+ S + I + G + ++ + R+ P GFAF E+E Sbjct: 6 NCTVYIGNVDERVSDRVLYDIMIQAGRVIDLHIPRDKETDKPKGFAFAEYE 56 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 31.9 bits (69), Expect = 0.45 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 5/57 (8%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDPRMLKTLF 272 ++V L +S+ +I++ F YG I+ V + + P G+AF+E+ R +K + Sbjct: 140 LFVSRLNYESSESKIKREFESYGPIKRVHLVTDQLTNKPKGYAFIEYMHTRDMKAAY 196 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 31.9 bits (69), Expect = 0.45 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN----PPGFAFVEFED 248 VYV NL + S E+ K+F ++G + + R+ GF FV FE+ Sbjct: 226 VYVKNLSESLSDEELNKVFGEFGVTTSCVIMRDGEGKSKGFGFVNFEN 273 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 31.5 bits (68), Expect = 0.60 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 4/56 (7%) Frame = +3 Query: 108 SCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN----PPGFAFVEFEDPRMLK 263 S VYV NL + + +FS+YG + +V V R+ GF FV F +P K Sbjct: 201 STNVYVKNLIETVTDDCLHTLFSQYGTVSSVVVMRDGMGRSRGFGFVNFCNPENAK 256 >At2g47580.1 68415.m05937 small nuclear ribonucleoprotein U1A / spliceosomal protein U1A / U1snRNP-specific protein identical to GB:Z49991 U1snRNP-specific protein [Arabidopsis thaliana] Length = 250 Score = 31.5 bits (68), Expect = 0.60 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFED 248 ++V NL + ++ +F +Y + V + PG AFVEF D Sbjct: 179 LFVQNLPHETTPMVLQMLFCQYQGFKEVRMIEAKPGIAFVEFAD 222 >At2g30260.1 68415.m03684 small nuclear ribonucleoprotein U2B, putative / spliceosomal protein, putative similar to spliceosomal protein [Solanum tuberosum] GI:169589 Length = 232 Score = 31.5 bits (68), Expect = 0.60 Identities = 12/44 (27%), Positives = 24/44 (54%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFED 248 +++ NL + ++ +F +Y + + + PG AFVE+ED Sbjct: 160 LFIQNLPHETTSMMLQLLFEQYPGFKEIRMIDAKPGIAFVEYED 203 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 31.5 bits (68), Expect = 0.60 Identities = 21/83 (25%), Positives = 34/83 (40%), Gaps = 5/83 (6%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDPRMLKTLFVD 278 KV+VG L + + F +YG+I V + G+ FV F DP + VD Sbjct: 25 KVFVGGLAWETQSETLRRHFDQYGDILEAVVITDKNTGRSKGYGFVTFRDPEAARRACVD 84 Query: 279 LMEHAAVAPGFVSKCQMVAQGET 347 + G + C + + G + Sbjct: 85 ---PTPIIDGRRANCNLASLGRS 104 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 31.1 bits (67), Expect = 0.79 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 5/66 (7%) Frame = +3 Query: 96 EWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDPRML 260 E DL K+++G + + + + FS YG++ + R+ GF F+ F DP + Sbjct: 2 ESDLG-KLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVS 60 Query: 261 KTLFVD 278 + + +D Sbjct: 61 ERVIMD 66 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 31.1 bits (67), Expect = 0.79 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 5/66 (7%) Frame = +3 Query: 96 EWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDPRML 260 E DL K+++G + + + + FS YG++ + R+ GF F+ F DP + Sbjct: 2 ESDLG-KLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVS 60 Query: 261 KTLFVD 278 + + +D Sbjct: 61 ERVIMD 66 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 31.1 bits (67), Expect = 0.79 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 5/66 (7%) Frame = +3 Query: 96 EWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDPRML 260 E DL K+++G + + + + FS YG++ + R+ GF F+ F DP + Sbjct: 2 ESDLG-KLFIGGISWDTDEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVS 60 Query: 261 KTLFVD 278 + + +D Sbjct: 61 ERVIMD 66 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 31.1 bits (67), Expect = 0.79 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 5/51 (9%) Frame = +3 Query: 105 LSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEF 242 ++ +VYVGNL + + + FS YGN+ + V R+ GF FV + Sbjct: 1 MATRVYVGNLSPTTTDDMLREAFSGYGNVVDAIVMRDRYTDRSRGFGFVTY 51 >At5g43960.2 68418.m05378 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 391 Score = 30.7 bits (66), Expect = 1.0 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 6/50 (12%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWV----ARNPPG--FAFVEFED 248 VYV NL ++ S EIE+ F +G I+ V ++ G +AFVEFED Sbjct: 259 VYVRNLPSDISASEIEEEFKNFGTIKPDGVFLRTRKDVMGVCYAFVEFED 308 >At5g43960.1 68418.m05379 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 450 Score = 30.7 bits (66), Expect = 1.0 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 6/50 (12%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWV----ARNPPG--FAFVEFED 248 VYV NL ++ S EIE+ F +G I+ V ++ G +AFVEFED Sbjct: 318 VYVRNLPSDISASEIEEEFKNFGTIKPDGVFLRTRKDVMGVCYAFVEFED 367 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 5/54 (9%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRN--VWVARN---PPGFAFVEFEDPRML 260 +++VG L + ++E+ FS++G+I + + + R+ GF F+ F D R + Sbjct: 8 RIFVGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAM 61 >At4g25500.2 68417.m03674 arginine/serine-rich splicing factor RSP40 (RSP40) identical to SP|P92965 Arginine/serine-rich splicing factor RSP40 {Arabidopsis thaliana} Length = 309 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 Query: 141 NASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFE 245 N ++EK F YG I NV + RN FAF+++E Sbjct: 67 NTRTRDLEKHFEPYGKIVNVRIRRN---FAFIQYE 98 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 30.7 bits (66), Expect = 1.0 Identities = 23/88 (26%), Positives = 42/88 (47%), Gaps = 4/88 (4%) Frame = +3 Query: 108 SCK-VYVGNLGTNASKYEIEKIFSKYGNIR-NVWVARNPPGFAFVEFEDPRMLKTLFVDL 281 +C+ VYVGN+ T ++ +++IF+ G + + + ++ + FV + D R + L Sbjct: 57 TCRSVYVGNIHTQVTEPLLQEIFTSTGPVESSKLIRKDKSSYGFVHYFDRRSAALAILSL 116 Query: 282 M-EHAAVAPGFVSKCQMVAQGE-TAGHF 359 H P V+ Q E T+ HF Sbjct: 117 NGRHLFGQPIKVNWAYATGQREDTSSHF 144 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 30.7 bits (66), Expect = 1.0 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 5/50 (10%) Frame = +3 Query: 108 SCKVYVGNLGTNASKYEIEKIFSKYGNI--RNVWVAR---NPPGFAFVEF 242 S K++VG + + ++ + + FSKYG + + V R GFAFV F Sbjct: 33 SSKIFVGGISYSTDEFGLREAFSKYGEVVDAKIIVDRETGRSRGFAFVTF 82 >At5g44200.1 68418.m05408 nuclear cap-binding protein, putative similar to SP|P52298 20 kDa nuclear cap binding protein (CBP20) (NCBP interacting protein 1) {Homo sapiens}; non-consensus AT donor splice site at exon 4, AC acceptor splice site at exon 5; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 257 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 5/50 (10%) Frame = +3 Query: 108 SCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWV-----ARNPPGFAFVEF 242 S VY+GN+ ++ ++ ++FS+ G I+ + + + P GF FV F Sbjct: 33 STTVYIGNVSFYTTEEQLYELFSRAGEIKKIIMGLDKNTKTPCGFCFVLF 82 >At5g10350.2 68418.m01201 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN----PPGFAFVEF 242 VYVGN+ + E++ F G + V + + P GFA+VEF Sbjct: 91 VYVGNVDYACTPEEVQLHFQTCGTVNRVTILMDKFGQPKGFAYVEF 136 >At5g10350.1 68418.m01200 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 217 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN----PPGFAFVEF 242 VYVGN+ + E++ F G + V + + P GFA+VEF Sbjct: 91 VYVGNVDYACTPEEVQLHFQTCGTVNRVTILMDKFGQPKGFAYVEF 136 >At2g42890.2 68415.m05312 RNA recognition motif (RRM)-containing protein Length = 830 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +3 Query: 129 NLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFEDPRMLKT 266 N+ T S E+ ++F YG IR + N F+E+ D R +T Sbjct: 276 NVDTTVSNDELLQLFGAYGEIREIRETPNRRFHRFIEYYDVRDAET 321 >At2g42890.1 68415.m05311 RNA recognition motif (RRM)-containing protein Length = 843 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +3 Query: 129 NLGTNASKYEIEKIFSKYGNIRNVWVARNPPGFAFVEFEDPRMLKT 266 N+ T S E+ ++F YG IR + N F+E+ D R +T Sbjct: 289 NVDTTVSNDELLQLFGAYGEIREIRETPNRRFHRFIEYYDVRDAET 334 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 5/57 (8%) Frame = +3 Query: 93 REWDLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFED 248 R ++ + +VYVGNL + +E++FS++G + V + GF FV D Sbjct: 238 RVYEPAFRVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSD 294 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 29.9 bits (64), Expect = 1.8 Identities = 25/99 (25%), Positives = 36/99 (36%), Gaps = 6/99 (6%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIR------NVWVARNPPGFAFVEFEDPRMLKTLFV 275 K+YV N+G ++ FSK+G I + + R P GF ++ K Sbjct: 246 KIYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGR-PKGFCLFVYKSSESAKRA-- 302 Query: 276 DLMEHAAVAPGFVSKCQMVAQGETAGHFFNKPPTHQRPH 392 L E G + CQ G G + H PH Sbjct: 303 -LEEPHKTFEGHILHCQKAIDGPKPG---KQQQHHHNPH 337 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 29.9 bits (64), Expect = 1.8 Identities = 25/99 (25%), Positives = 36/99 (36%), Gaps = 6/99 (6%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIR------NVWVARNPPGFAFVEFEDPRMLKTLFV 275 K+YV N+G ++ FSK+G I + + R P GF ++ K Sbjct: 246 KIYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGR-PKGFCLFVYKSSESAKRA-- 302 Query: 276 DLMEHAAVAPGFVSKCQMVAQGETAGHFFNKPPTHQRPH 392 L E G + CQ G G + H PH Sbjct: 303 -LEEPHKTFEGHILHCQKAIDGPKPG---KQQQHHHNPH 337 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 29.9 bits (64), Expect = 1.8 Identities = 25/99 (25%), Positives = 36/99 (36%), Gaps = 6/99 (6%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIR------NVWVARNPPGFAFVEFEDPRMLKTLFV 275 K+YV N+G ++ FSK+G I + + R P GF ++ K Sbjct: 246 KIYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGR-PKGFCLFVYKSSESAKRA-- 302 Query: 276 DLMEHAAVAPGFVSKCQMVAQGETAGHFFNKPPTHQRPH 392 L E G + CQ G G + H PH Sbjct: 303 -LEEPHKTFEGHILHCQKAIDGPKPG---KQQQHHHNPH 337 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 29.9 bits (64), Expect = 1.8 Identities = 27/94 (28%), Positives = 39/94 (41%), Gaps = 3/94 (3%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGN--IRNVWVARNPPGFAFVEFEDPRMLKTLFVDLMEH 290 VYVGNL S+ ++ + F G I V V R+ GF FV + + L + + Sbjct: 262 VYVGNLAPEVSQVDLHRHFHSLGAGVIEEVRVQRD-KGFGFVRY-STHVEAALAIQMGNT 319 Query: 291 AAVAPGFVSKCQMVAQGETAGHFFNK-PPTHQRP 389 + G KC ++ AG N PP P Sbjct: 320 HSYLSGRQMKCSWGSKPTPAGTASNPLPPPAPAP 353 >At5g58130.1 68418.m07273 RNA recognition motif (RRM)-containing protein Length = 748 Score = 29.5 bits (63), Expect = 2.4 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNV-WVARNPPGFAFVEF 242 +++VG LG + + ++ KIFS G + V +V FA+++F Sbjct: 11 RLHVGGLGESVGRDDLLKIFSPMGTVDAVEFVRTKGRSFAYIDF 54 >At3g21215.1 68416.m02681 RNA-binding protein, putative contains RNA recognition motif, Pfam:PF00076; contains AT-AC splice sites at intron 8 Length = 339 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNP-PGFAFVEFED 248 +++GNLG N ++ E+ + S + + + R F+EFED Sbjct: 235 LFIGNLGENINEEELRSLLSAQPGFKQMKILRQERHTVCFIEFED 279 >At3g13700.1 68416.m01731 RNA-binding protein, putative similar to mec-8 [Caenorhabditis elegans] GI:1370048; contains Pfam profile:PF00076 rrm:RNA recognition motif Length = 296 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/45 (28%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWV-ARNPPGFAFVEFED 248 +++ NLG N ++ E++++ S+Y + + AR AF +FE+ Sbjct: 225 LFIANLGPNCTEDELKQLLSRYPGFHILKIRARGGMPVAFADFEE 269 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 29.5 bits (63), Expect = 2.4 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 5/49 (10%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNV-----WVARNPPGFAFVEFE 245 K+YV L ++ + F ++GN+ ++ VA P GFAF+ +E Sbjct: 78 KLYVSGLSFRTTEDTLRDTFEQFGNLIHMNMVMDKVANRPKGFAFLRYE 126 >At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 501 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNP 218 V+VGNL K I K FSK+G + +V + P Sbjct: 173 VFVGNLPLKVKKKVILKEFSKFGEVESVRIRSVP 206 >At5g16300.1 68418.m01905 expressed protein Length = 1068 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = -1 Query: 346 VSPCATI*HFDTNPGATAACSIKSTNRVFSIRGSSNSTNA 227 + PC+T+ F P + A S +STN+V SI +SN +A Sbjct: 947 IMPCSTVPRFKYLPISAPALSSRSTNKV-SIPVTSNDASA 985 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 29.1 bits (62), Expect = 3.2 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 5/50 (10%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNP-----PGFAFVEFED 248 +VY+GNL + ++ +I K+FS I +V + +N G+A V+F+D Sbjct: 263 RVYIGNLAWDTTERDIRKLFSDC-VINSVRLGKNKETGEFKGYAHVDFKD 311 >At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 29.1 bits (62), Expect = 3.2 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 5/52 (9%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWV-----ARNPPGFAFVEFEDPR 254 KV+VG L + K + F KYG+I + R G+ FV F+D + Sbjct: 18 KVFVGGLAWDTHKEAMYDHFIKYGDILEAVIISDKLTRRSKGYGFVTFKDAK 69 >At5g19960.1 68418.m02376 RNA recognition motif (RRM)-containing protein low similarity to glycine-rich RNA-binding protein [Euphorbia esula] GI:2645699; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 337 Score = 28.7 bits (61), Expect = 4.2 Identities = 25/96 (26%), Positives = 42/96 (43%), Gaps = 4/96 (4%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVA--RNPPG--FAFVEFEDPRMLKTLFVDLM 284 VYVG L + ++ + ++FS YG++ V + R+ G + FV F + R D M Sbjct: 9 VYVGGLPYDITEEAVRRVFSIYGSVLTVKIVNDRSVRGKCYGFVTFSNRRSADDAIED-M 67 Query: 285 EHAAVAPGFVSKCQMVAQGETAGHFFNKPPTHQRPH 392 + ++ + V T G N P +PH Sbjct: 68 DGKSIG----GRAVRVNDVTTRGGRMNPGPGRLQPH 99 >At5g12080.2 68418.m01415 mechanosensitive ion channel domain-containing protein / MS ion channel domain-containing protein contains Pfam profile PF00924: Mechanosensitive ion channel Length = 734 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/62 (25%), Positives = 30/62 (48%) Frame = +1 Query: 1 VVASD*KIKFSEIL*IIFIHPFQSKLRCLATENGIFLAKCTWATWVLMRLNMK*KKYFLN 180 ++ S K F I+ + +HP+ RC+ + + + T V ++LN + K Y+ N Sbjct: 554 IIGSTCKNLFESIVFVFVMHPYDVGDRCVVDGVAMLVEEMNLLTTVFLKLNNE-KVYYPN 612 Query: 181 TV 186 V Sbjct: 613 AV 614 >At5g12080.1 68418.m01414 mechanosensitive ion channel domain-containing protein / MS ion channel domain-containing protein contains Pfam profile PF00924: Mechanosensitive ion channel Length = 734 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/62 (25%), Positives = 30/62 (48%) Frame = +1 Query: 1 VVASD*KIKFSEIL*IIFIHPFQSKLRCLATENGIFLAKCTWATWVLMRLNMK*KKYFLN 180 ++ S K F I+ + +HP+ RC+ + + + T V ++LN + K Y+ N Sbjct: 554 IIGSTCKNLFESIVFVFVMHPYDVGDRCVVDGVAMLVEEMNLLTTVFLKLNNE-KVYYPN 612 Query: 181 TV 186 V Sbjct: 613 AV 614 >At5g03580.1 68418.m00316 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein [Triticum aestivum] GI:1737492; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 101 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN----PPGFAFVEFE 245 +Y+ NL S+ + +FS +G + +A++ GFAF+EFE Sbjct: 19 LYIANLDAQVSEEMLFLMFSDFGKVIRSVLAKDFRGESRGFAFIEFE 65 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 28.7 bits (61), Expect = 4.2 Identities = 17/60 (28%), Positives = 24/60 (40%), Gaps = 5/60 (8%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDPRMLKTLFVD 278 KV+VG L + + F +YG I V + G+ FV F DP + D Sbjct: 25 KVFVGGLAWETQSETLRQHFEQYGEILEAVVIADKNTGRSKGYGFVTFRDPEAARRACAD 84 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/59 (25%), Positives = 29/59 (49%), Gaps = 5/59 (8%) Frame = +3 Query: 102 DLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDPRMLK 263 D+ + +VG L +E F++YG++ + + + GF FV F+D + +K Sbjct: 5 DVEYRCFVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMK 63 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/59 (25%), Positives = 29/59 (49%), Gaps = 5/59 (8%) Frame = +3 Query: 102 DLSCKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARN-----PPGFAFVEFEDPRMLK 263 D+ + +VG L +E F++YG++ + + + GF FV F+D + +K Sbjct: 5 DVEYRCFVGGLAWATDDRALETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMK 63 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWV 206 K++VGNL N ++ ++F GN+ V V Sbjct: 100 KLFVGNLSFNVDSAQLAQLFESAGNVEMVEV 130 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWV 206 K++VGNL N ++ ++F GN+ V V Sbjct: 100 KLFVGNLSFNVDSAQLAQLFESAGNVEMVEV 130 >At3g16090.1 68416.m02033 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 492 Score = 27.9 bits (59), Expect = 7.3 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +1 Query: 484 TQLLRADEDQQLRPHNNPSHSSHLILNFT*T--WELKTHSETSNSRENNQVH*IE 642 T+ + + DQ L HN P +SH N + T E++ ET N++H +E Sbjct: 416 TEQVSTEPDQTLPQHNLPVENSHAYANMSETKLEEMRKSLETHLEILRNRLHFLE 470 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 27.9 bits (59), Expect = 7.3 Identities = 16/61 (26%), Positives = 27/61 (44%), Gaps = 5/61 (8%) Frame = +3 Query: 114 KVYVGNLGTNASKYEIEKIFSKYGNIRNVWV-----ARNPPGFAFVEFEDPRMLKTLFVD 278 +VYVGNL +E +FS+ G + V + GF FV ++ + ++ Sbjct: 205 RVYVGNLSWGVDDMALESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKS 264 Query: 279 L 281 L Sbjct: 265 L 265 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 27.9 bits (59), Expect = 7.3 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGN--IRNVWVARNPPGFAFVEF 242 VYVGNL ++ ++ ++F G I V V R+ GF FV + Sbjct: 275 VYVGNLSPEVTQLDLHRLFYTLGAGVIEEVRVQRD-KGFGFVRY 317 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 27.9 bits (59), Expect = 7.3 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +3 Query: 117 VYVGNLGTNASKYEIEKIFSKYGN--IRNVWVARNPPGFAFVEF 242 VYVGNL ++ ++ ++F G I V V R+ GF FV + Sbjct: 271 VYVGNLSPEVTQLDLHRLFYTLGAGVIEEVRVQRD-KGFGFVRY 313 >At5g16300.2 68418.m01906 expressed protein Length = 1034 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -1 Query: 346 VSPCATI*HFDTNPGATAACSIKSTNRVFSIRGSSNSTN 230 + PC+T+ F P + A S +STN+V SI +SN + Sbjct: 947 IMPCSTVPRFKYLPISAPALSSRSTNKV-SIPVTSNDAS 984 >At1g71930.1 68414.m08315 no apical meristem (NAM) family protein similar to NAM GB:CAA63101 from [Petunia x hybrida] Length = 324 Score = 27.5 bits (58), Expect = 9.7 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 349 QAIFSTNHQHTNDLTTSLHNYG 414 Q + S NH + N+ ++S+H YG Sbjct: 207 QMLMSNNHYNPNNTSSSMHQYG 228 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +3 Query: 111 CKVYVGNLGTNASKYEIEKIFSKYGNIRNVWVARNP 218 C++YV N+ + ++ +F +G + +V V+RNP Sbjct: 108 CELYVCNIPRSYDIAQLLDMFQPFGTVISVEVSRNP 143 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,143,353 Number of Sequences: 28952 Number of extensions: 334782 Number of successful extensions: 1134 Number of sequences better than 10.0: 114 Number of HSP's better than 10.0 without gapping: 1026 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1111 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1604469728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -