BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30405 (764 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0014 - 31012116-31012229,31012773-31012985,31013058-310131... 32 0.44 03_05_0415 - 24019330-24019539,24020948-24021099,24021765-240218... 29 3.1 11_04_0019 + 12311674-12311886,12312746-12312878,12312918-123131... 29 4.1 12_02_0318 - 17457182-17462232,17462745-17462955,17463356-174634... 29 5.4 >03_06_0014 - 31012116-31012229,31012773-31012985,31013058-31013171, 31013909-31014040,31014624-31014692,31014763-31015017, 31015347-31015520,31016104-31016280,31016999-31017107, 31017343-31017506,31018221-31018517 Length = 605 Score = 32.3 bits (70), Expect = 0.44 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +3 Query: 102 VTNKRKPDTQEEIPA-KIPKTDVNDDCKTNSEELIVETTAKD 224 VTN +K + + +P+ +PK VN+ K+ SEE ET +D Sbjct: 492 VTNAKKANVGKAVPSPSVPKHQVNEYSKSESEESEYETDVED 533 >03_05_0415 - 24019330-24019539,24020948-24021099,24021765-24021846, 24021930-24022068,24022775-24023127 Length = 311 Score = 29.5 bits (63), Expect = 3.1 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +1 Query: 457 RGSHSRCKVSRAPYRESCTEAASVPEKTTPATITEI 564 RG H RC A YRE+ AAS TT TEI Sbjct: 39 RGGHLRCS---AGYREAAAAAASTSSTTTTPRPTEI 71 >11_04_0019 + 12311674-12311886,12312746-12312878,12312918-12313125, 12313342-12313558,12313564-12313848 Length = 351 Score = 29.1 bits (62), Expect = 4.1 Identities = 18/60 (30%), Positives = 32/60 (53%) Frame = +3 Query: 135 EIPAKIPKTDVNDDCKTNSEELIVETTAKDATVEKAAEEPKKWKLKNLLQYQQMTRQKQR 314 EI A+ P ND ++EL++E T K K E+P + KL + + +++ R+K + Sbjct: 282 EIHAEFPGAGNND-----AQELLLEDTGKTTHTGKKLEQPAQKKLPSAPKPKKVCREKPK 336 >12_02_0318 - 17457182-17462232,17462745-17462955,17463356-17463403, 17466161-17466346 Length = 1831 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 318 VPFVFVESFAGTATDSSTSIFLALPPLF 235 VP+ FV +F SS + ALPP+F Sbjct: 391 VPYAFVSAFEALLKSSSNAPSFALPPIF 418 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,689,983 Number of Sequences: 37544 Number of extensions: 237068 Number of successful extensions: 699 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 699 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2051430072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -