BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30404 (726 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37504| Best HMM Match : PIP5K (HMM E-Value=0) 33 0.24 SB_31341| Best HMM Match : UDP-g_GGTase (HMM E-Value=0) 30 2.2 SB_34154| Best HMM Match : UvrD-helicase (HMM E-Value=0.064) 28 6.7 >SB_37504| Best HMM Match : PIP5K (HMM E-Value=0) Length = 2119 Score = 33.1 bits (72), Expect = 0.24 Identities = 18/52 (34%), Positives = 31/52 (59%) Frame = +3 Query: 324 YFMNYNLIDMLNVIVYEKINSLKNFGNRYAIYKPSLLEEFRTLNWLLENKLL 479 Y N N + L+ +V ++ N LKNF +R A +P++L +T++ L + LL Sbjct: 618 YQRNENRLASLDPLVLQERNFLKNFVSRVAALRPNVLLVEKTVSRLAQEMLL 669 >SB_31341| Best HMM Match : UDP-g_GGTase (HMM E-Value=0) Length = 1031 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 503 KLEDEDEIECFILAKRRKLHIDSLENL 583 K ED+DE+E F+ K +KLH E L Sbjct: 154 KKEDDDEVEGFLFGKLKKLHPHLTEQL 180 >SB_34154| Best HMM Match : UvrD-helicase (HMM E-Value=0.064) Length = 1064 Score = 28.3 bits (60), Expect = 6.7 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = +1 Query: 34 KYLDDNSPYPKPYEFISSSVKSDENNMAIKHLMSDLKLAEPTFMFNP-VDVENMQYQI 204 KY+ S YP PY+ S K + N + L ++L FN + +E MQ ++ Sbjct: 309 KYVVGLSQYPIPYDLRVSLNKGEPTNALLDLLSAELTATNHEAKFNALLHMEEMQMEV 366 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,179,385 Number of Sequences: 59808 Number of extensions: 383296 Number of successful extensions: 835 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 810 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 835 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -