BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30402 (721 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 23 3.3 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 4.4 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 22 5.8 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 22 5.8 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 7.6 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 22.6 bits (46), Expect = 3.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 8 VKHNKQKANALFFTSSVSLKFNL 76 V++N+Q + F VSL FNL Sbjct: 127 VRNNRQIRRMVVFLIGVSLSFNL 149 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/40 (25%), Positives = 16/40 (40%) Frame = +1 Query: 37 VIFHILCFFEI*FEITAVTAYRS*SVCCE*FYIYYRFVCC 156 V+ +LC + + T + VC FY + CC Sbjct: 231 VLIILLCIYYFYYAFILFTVHLLLLVCIYYFYYMHLLFCC 270 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -3 Query: 596 PQDDP*DGSAAR*CK 552 PQD P D S A CK Sbjct: 63 PQDSPYDASVAAACK 77 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.8 bits (44), Expect = 5.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 336 SGESARRGTGTPTGSASITSYARPP 262 S +A R TPTG + ++ A PP Sbjct: 210 SPAAAPRSVATPTGIPTPSTSASPP 234 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 7.6 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = +2 Query: 518 PRWRPTRKNARPYINELRSRLKDHLEGVEKTRLTLGTADP 637 P+ +KN + ELR + + ++K L L A P Sbjct: 213 PKGSEDKKNYVLLLKELREAFEAEAQEIKKPALLLSAAVP 252 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,339 Number of Sequences: 336 Number of extensions: 2641 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19155320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -