BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30392 (708 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18178| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_55149| Best HMM Match : Ldl_recept_a (HMM E-Value=2.6e-23) 42 4e-04 SB_43823| Best HMM Match : MAM (HMM E-Value=0) 41 9e-04 SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) 41 0.001 SB_30577| Best HMM Match : Ldl_recept_a (HMM E-Value=2.8e-25) 39 0.005 SB_48688| Best HMM Match : Ldl_recept_a (HMM E-Value=7.8e-26) 38 0.011 SB_18810| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_5319| Best HMM Match : Ldl_recept_a (HMM E-Value=7.56701e-44) 37 0.014 SB_47409| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-17) 37 0.018 SB_45709| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_10498| Best HMM Match : Ldl_recept_a (HMM E-Value=2.7e-07) 36 0.024 SB_53569| Best HMM Match : EGF_CA (HMM E-Value=0) 36 0.032 SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.043 SB_50311| Best HMM Match : Ldl_recept_a (HMM E-Value=3.4e-20) 35 0.074 SB_19979| Best HMM Match : Mo-co_dimer (HMM E-Value=6) 35 0.074 SB_29580| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-38) 34 0.098 SB_56441| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.098 SB_51898| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.098 SB_35576| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.098 SB_21487| Best HMM Match : MAM (HMM E-Value=0) 33 0.17 SB_47789| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-34) 33 0.17 SB_58590| Best HMM Match : Polysacc_deac_1 (HMM E-Value=2.6e-08) 33 0.23 SB_19614| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_13477| Best HMM Match : Ldl_recept_a (HMM E-Value=0) 33 0.23 SB_27746| Best HMM Match : MAM (HMM E-Value=1.4013e-45) 33 0.23 SB_45605| Best HMM Match : MAM (HMM E-Value=2.1e-16) 33 0.30 SB_4238| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_27121| Best HMM Match : CBM_14 (HMM E-Value=5.8e-29) 32 0.40 SB_27119| Best HMM Match : CBM_14 (HMM E-Value=4.1e-15) 32 0.40 SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) 32 0.52 SB_43832| Best HMM Match : CBM_14 (HMM E-Value=2.8e-16) 31 0.69 SB_24224| Best HMM Match : Lectin_C (HMM E-Value=0) 31 0.92 SB_44732| Best HMM Match : TSP_1 (HMM E-Value=0) 31 1.2 SB_6273| Best HMM Match : MAM (HMM E-Value=0) 31 1.2 SB_50657| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_641| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_35350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_26236| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_13199| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_31927| Best HMM Match : Ldl_recept_a (HMM E-Value=2.3e-27) 29 3.7 SB_24031| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_23898| Best HMM Match : Ldl_recept_a (HMM E-Value=1.4013e-45) 29 3.7 SB_40871| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_30805| Best HMM Match : Neur_chan_LBD (HMM E-Value=2.9e-06) 28 6.5 SB_2014| Best HMM Match : MAM (HMM E-Value=0) 28 6.5 SB_35754| Best HMM Match : DUF755 (HMM E-Value=2.4) 28 8.5 SB_33423| Best HMM Match : Ldl_recept_a (HMM E-Value=7.8e-22) 28 8.5 SB_31087| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-32) 28 8.5 >SB_18178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 489 Score = 44.8 bits (101), Expect = 7e-05 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +3 Query: 498 WQRSCIEKELFCNGKPDCKDESDENACTVELDPNR 602 W + CI+ C+GKP+C D SDEN C ++P+R Sbjct: 281 WWKQCIDISYKCDGKPECADHSDENDCPPLINPDR 315 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDEN 572 CI + C+GK DC D SDE+ Sbjct: 371 CIPPQWICDGKDDCGDRSDES 391 >SB_55149| Best HMM Match : Ldl_recept_a (HMM E-Value=2.6e-23) Length = 190 Score = 42.3 bits (95), Expect = 4e-04 Identities = 21/57 (36%), Positives = 28/57 (49%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCVLPDCFCSADGTRIPGG 680 CI K C+G+ DC D SDE C ++ +C+ NQCV C + PGG Sbjct: 103 CIPKSWRCDGEMDCPDSSDEEGCVNRTCSSKEFNCN-NQCVPLSWKCDGEKDCRPGG 158 >SB_43823| Best HMM Match : MAM (HMM E-Value=0) Length = 1724 Score = 41.1 bits (92), Expect = 9e-04 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = +3 Query: 504 RSCIEKELFCNGKPDCKDESDENACTVELDPNRAPDC 614 + C+ + L C+GKPDC D SDE C V NR C Sbjct: 1354 QKCLNRTLQCDGKPDCSDYSDEAHCRVRKSINRNVVC 1390 Score = 37.1 bits (82), Expect = 0.014 Identities = 18/43 (41%), Positives = 22/43 (51%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCVLP 638 CI+ C+G PDC D SDE+ C PN DC+ Q P Sbjct: 1316 CIKSSFVCDGVPDCNDHSDEDDC-----PN--SDCNLEQIYCP 1351 Score = 29.9 bits (64), Expect = 2.1 Identities = 27/115 (23%), Positives = 44/115 (38%) Frame = +1 Query: 346 TCPSGLAFDLDKQTCDWKGKVNNCDKLEKPRKVLPILKTDEPICPEGKLACGSGVALKKN 525 TC S K + W G V + + P ++P D C C + + Sbjct: 1516 TCSSNNGTRTCKCSPSWSGSVCSKLNITCPAGLIPCAVGDNGQCENSTSVCSNNY----D 1571 Query: 526 CSVMVNQTAKMNPMKMLALSNWTQIERLTVXLTSASYLTVSVLLTVHVFQVEFDP 690 C + +Q + P +A+ I + V L A +LT +H+F V +DP Sbjct: 1572 CGLTQDQLSNYCP-PYIAVGVAGGILLIIVVLIVAYFLTKGRRKKLHLFNVFYDP 1625 >SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) Length = 3891 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/51 (33%), Positives = 22/51 (43%) Frame = +3 Query: 507 SCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCVLPDCFCSAD 659 +CI +E C+ + DC D SDE C PN C C+ C D Sbjct: 2468 TCITREWRCDHQDDCGDGSDEQQCVNYTCPNHTFKCTSGHCIANSSVCDGD 2518 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCVLPDCFCSAD 659 C+ + C+G DC+D SDE C V C +C+ D C D Sbjct: 3019 CVYRSRVCDGIDDCRDGSDERNCHVTTCTADQFRCPSGRCISRDWLCDGD 3068 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +3 Query: 504 RSCIEKELFCNGKPDCKDESDENACTVELDPNRAPDC-DXNQCVLPDCFC 650 R CI+++ C+G+ DC D SDE C +E N C + ++C+ C Sbjct: 1098 RHCIQRKWICDGENDCGDRSDEVDCGLESCGNDRWRCSNTSRCIAKSQVC 1147 Score = 36.3 bits (80), Expect = 0.024 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = +3 Query: 504 RSCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCVLPDCFC 650 R CI + C+G+ DC D SDE C + C +C+ C Sbjct: 3139 RRCIPNQWKCDGESDCNDGSDEKGCPPKQCAKHQYRCASGRCISASWVC 3187 Score = 35.5 bits (78), Expect = 0.043 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCVLPDCFCSAD 659 CI + C+ + DC D SDE C P C +CV D C + Sbjct: 2221 CINAKWVCDRENDCGDNSDEARCPEVTCPAHEFTCPNGRCVSYDFLCDGE 2270 Score = 34.7 bits (76), Expect = 0.074 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDE-NACTVEL-DPNRAPDCDXNQCV 632 CI K C+G+ DC D SDE + C+ + DP C +C+ Sbjct: 59 CIPKSAVCDGENDCGDMSDEPSNCSAHICDPKLEFQCANGRCI 101 Score = 34.3 bits (75), Expect = 0.098 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENA--CTVELDPNRAPDCDXNQCVLPDCFCSAD 659 CI ++ C+G DC D SDE A C V +A +C+ + C + Sbjct: 3058 CISRDWLCDGDNDCGDSSDEKAGECHVTCPAGQARCATGRRCIPSEWRCDGE 3109 Score = 34.3 bits (75), Expect = 0.098 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = +3 Query: 504 RSCIEKELFCNGKPDCKDESDENA--CT 581 R CI E C+G+ DC+D SDEN+ CT Sbjct: 3097 RRCIPSEWRCDGESDCEDGSDENSAQCT 3124 Score = 32.7 bits (71), Expect = 0.30 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENAC 578 CI K+ C+G DC D SDE+ C Sbjct: 100 CINKKWRCDGMKDCADGSDESTC 122 Score = 32.3 bits (70), Expect = 0.40 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDE--NACTVELDPNRAPDCDXNQCV 632 C+++ C+ DC D SDE C + N CD N+C+ Sbjct: 3258 CVDRRWLCDDMDDCGDYSDELRLLCRYSICRNSHFRCDNNKCI 3300 Score = 31.9 bits (69), Expect = 0.52 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCV 632 CI + C+G DC D SDE P R C + CV Sbjct: 3219 CIARAWKCDGMMDCADASDEKGSGHRWCPQRLYQCINHVCV 3259 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/48 (29%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENAC-TVELDPNRAPDCDXNQCVLPDCFC 650 C+ + C+G+ DC D SDE C P + N C+ C Sbjct: 2260 CVSYDFLCDGEDDCGDFSDELRCPPTTCVPGQVKCGSKNLCIPSSWLC 2307 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCVLPDCFCSADGTRIPGGI 683 CI K C+G+ DC D SDE P C +QC + C+ +P G+ Sbjct: 1140 CIAKSQVCDGRVDCPDASDE-----------GPGCGLDQCHSNNGGCAQLCMDVPEGV 1186 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENA---CTVELDPNRAPDCDXNQCVLPDCFCSAD 659 C+ K C+G DC D SDE++ + +P C+ +C+ C + Sbjct: 2180 CVRKSFVCDGDNDCHDGSDESSLVCASWTCEPGHF-SCNNGRCINAKWVCDRE 2231 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDE-NACTVEL-DPNRAPDCDXNQCV 632 CI + C+G+ DC D SDE ++C V + P D +C+ Sbjct: 2938 CISRLWRCDGEDDCGDGSDEPDSCPVRVCKPGTYQCADNRKCI 2980 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACT 581 CI C+ DC D SDE CT Sbjct: 1060 CIPLRFVCDADDDCGDRSDERNCT 1083 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDE 569 CI L C+G DC D SDE Sbjct: 2382 CISTRLLCDGDNDCGDNSDE 2401 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENAC 578 CI C+G DC D SDE C Sbjct: 2508 CIANSSVCDGDTDCADGSDEKDC 2530 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCV 632 CI C+ DC D SDE C + CD C+ Sbjct: 3180 CISASWVCDHVNDCGDGSDEQQCINRTCADGQFSCDDGLCI 3220 Score = 27.9 bits (59), Expect = 8.5 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENAC 578 C ++ C+G DC D SDE C Sbjct: 922 CKPRDWVCDGFDDCGDGSDEKGC 944 Score = 27.9 bits (59), Expect = 8.5 Identities = 16/51 (31%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAP-DCDXNQCVLPDCFCSAD 659 CI C+G DC D DE E N + C +CV C D Sbjct: 2300 CIPSSWLCDGSDDCGDGWDERQDCRERPCNVSEFRCTSGECVPASWRCDGD 2350 >SB_30577| Best HMM Match : Ldl_recept_a (HMM E-Value=2.8e-25) Length = 147 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCVLPDCFCSAD 659 C+ +EL C+G C D SDE C + PD +CV P FC+ + Sbjct: 50 CVGQELRCDGDYACVDHSDERNCACRSAEFKCPD---GKCVHPSKFCNGE 96 Score = 36.3 bits (80), Expect = 0.024 Identities = 17/48 (35%), Positives = 21/48 (43%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCVLPDCFCS 653 C+ FCNG+ DC D SDE +C A C CV C+ Sbjct: 86 CVHPSKFCNGESDCTDGSDEWSCDNSCSSRHA--CADGTCVTWSLTCN 131 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 507 SCIEKELFCNGKPDCKDESDE 569 +C+ L CNG DC+D SDE Sbjct: 122 TCVTWSLTCNGVSDCQDGSDE 142 >SB_48688| Best HMM Match : Ldl_recept_a (HMM E-Value=7.8e-26) Length = 351 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCVLPDCFCSAD 659 C+ +E+ C+G C D SDE C + PD +CV P FC+ + Sbjct: 50 CVGQEVRCDGDYACVDHSDERNCACRSAEFKCPD---GKCVHPSKFCNGE 96 Score = 36.3 bits (80), Expect = 0.024 Identities = 17/48 (35%), Positives = 21/48 (43%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCVLPDCFCS 653 C+ FCNG+ DC D SDE +C A C CV C+ Sbjct: 86 CVHPSKFCNGESDCTDGSDEWSCDNSCSSRHA--CADGTCVTWSLTCN 131 Score = 31.5 bits (68), Expect = 0.69 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +3 Query: 507 SCIEKELFCNGKPDCKDESDENACTVELDPNRAP 608 +C+ L CNG DC+D SDE + D R P Sbjct: 122 TCVTWSLTCNGVSDCQDGSDEPKLCGKHDTMRPP 155 >SB_18810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.014 Identities = 18/43 (41%), Positives = 22/43 (51%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCVLP 638 CI+ C+G PDC D SDE+ C PN DC+ Q P Sbjct: 19 CIKSSFVCDGVPDCNDHSDEDDC-----PN--SDCNLEQIYCP 54 Score = 37.1 bits (82), Expect = 0.014 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +3 Query: 504 RSCIEKELFCNGKPDCKDESDENACTVE 587 + C+ + L C+GKPDC D SDE C E Sbjct: 57 QKCLNRTLQCDGKPDCSDYSDEAHCRGE 84 >SB_5319| Best HMM Match : Ldl_recept_a (HMM E-Value=7.56701e-44) Length = 212 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +3 Query: 504 RSCIEKELFCNGKPDCKDESDENACTVELDPNRAPDC-DXNQCVLPDCFC 650 R CI+++ C+G+ DC D SDE C +E N C + ++C+ C Sbjct: 125 RHCIQRKWICDGENDCGDRSDEVDCGLESCGNDRWRCSNTSRCIAKSQVC 174 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDE 569 CI K C+G+ DC D SDE Sbjct: 167 CIAKSQVCDGRVDCPDASDE 186 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACT 581 CI C+ DC D SDE CT Sbjct: 87 CIPLRFVCDADDDCGDRSDERNCT 110 >SB_47409| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-17) Length = 1571 Score = 36.7 bits (81), Expect = 0.018 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTV-ELDPNRAPDCDXNQCVLPD 641 C+ + L CNG+ DC+D SDE C + + AP + VL D Sbjct: 739 CVPQTLRCNGQMDCRDASDEQDCGIPTVTTTSAPQPTKGKTVLGD 783 >SB_45709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1112 Score = 36.3 bits (80), Expect = 0.024 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNR 602 CI+ C+G DC+D SDE C + L P R Sbjct: 142 CIKASWLCDGASDCQDNSDEMNCPLTLAPGR 172 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAP----DCDXNQCVLPDCF 647 C+ KE C+G DC D SDE+ C P P C +QCV P+ F Sbjct: 313 CVLKEWLCDGMDDCGDSSDEDNCPTR-PPYTCPPSDFTCANSQCV-PNSF 360 Score = 34.7 bits (76), Expect = 0.074 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENAC--TVELDPNRAPDCDXNQCVLPDCFCSAD 659 C+ C+G+ DC D SDE+ C T N CD +C+ C + Sbjct: 355 CVPNSFRCDGENDCGDRSDESGCKPTTTCSANEF-RCDDGRCITSTFRCDRE 405 Score = 31.5 bits (68), Expect = 0.69 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCV-LPDCFCSADGT 665 C+ + C+G+ DC D SDE C + C +C+ LP DGT Sbjct: 483 CVHRRWICDGERDCLDGSDEAGCGTIGCSSDEFTCTNQKCIPLPQ---KCDGT 532 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/45 (33%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAP-DCDXNQCVLPD 641 CI C+ + DC D SDE C P P C N+ + D Sbjct: 435 CIPGRFRCDHRSDCLDGSDEQNCQNVTRPTPPPVKCRKNERMCAD 479 >SB_10498| Best HMM Match : Ldl_recept_a (HMM E-Value=2.7e-07) Length = 106 Score = 36.3 bits (80), Expect = 0.024 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +3 Query: 507 SCIEKELFCNGKPDCKDESDENAC 578 +CI++ CNGK DC D SDE C Sbjct: 15 TCIDRNEHCNGKIDCPDASDEKGC 38 >SB_53569| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 921 Score = 35.9 bits (79), Expect = 0.032 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELD--PNRAPDCDXN 623 C +K +C+G+ DC D SDE C+ + P A C N Sbjct: 236 CEDKRWWCDGQDDCNDGSDEKNCSASANPTPTNAQGCKLN 275 >SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1831 Score = 35.5 bits (78), Expect = 0.043 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 349 CPSGLAFDLDKQTCDWKGKVNNCDK-LEKPRKVLPILKTDEPIC 477 CP+GL + + K CDW V +CD+ P P+ T +P C Sbjct: 1269 CPAGLKWSVKKTACDWPRYV-DCDRTTSTPPTPTPLTPTTKPAC 1311 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +1 Query: 349 CPSGLAFDLDKQTCDWKGKVNNCD-KLEKPRKVLPILKTDEPIC 477 C GL + + K TCDW V +CD K P P T +P C Sbjct: 814 CSPGLKWSITKTTCDWPRNV-DCDRKTPTPPSPTPPTTTPKPAC 856 Score = 31.9 bits (69), Expect = 0.52 Identities = 23/66 (34%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = +1 Query: 349 CPSGLAFDLDKQTCDWKGKVNNCDKLEKPRKVLPILKTDEP-ICPEGKLACGSGVALKKN 525 CP+GL + + K CDW V +CD + P T P I P L C + + L Sbjct: 919 CPAGLKWSVKKTACDWPRYV-DCD---RTTSTPPTPTTHTPTIKPACDLHCQT-LNLDGT 973 Query: 526 CSVMVN 543 C+VM N Sbjct: 974 CTVMPN 979 Score = 31.5 bits (68), Expect = 0.69 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 349 CPSGLAFDLDKQTCDWKGKVNNCDK 423 CP+GL + + K TCDW V +CD+ Sbjct: 1024 CPAGLKWSVKKTTCDWPRYV-DCDR 1047 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 349 CPSGLAFDLDKQTCDWKGKVNNCDK 423 CP+GL + + K CDW V +CD+ Sbjct: 1169 CPAGLKWSVKKTACDWPRYV-DCDR 1192 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 346 TCPSGLAFDLDKQTCDWKGKVNNCDKLEKPRKVLPIL 456 +CP GL ++++K CD V NC++ E L IL Sbjct: 1484 SCPHGLKWNIEKNACDHPVNV-NCNREEYDVLTLGIL 1519 >SB_50311| Best HMM Match : Ldl_recept_a (HMM E-Value=3.4e-20) Length = 772 Score = 34.7 bits (76), Expect = 0.074 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCVLPDCFC 650 CI K L+C+G C D SDE C P+ C +C++ C Sbjct: 103 CIRKNLYCDGDFACVDGSDETRCEC---PSNMFLCPSGECIMGTQLC 146 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENAC 578 CI C+GK DC D +DE C Sbjct: 139 CIMGTQLCDGKKDCTDNTDEKNC 161 >SB_19979| Best HMM Match : Mo-co_dimer (HMM E-Value=6) Length = 551 Score = 34.7 bits (76), Expect = 0.074 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -1 Query: 279 KYSSAGLPCTTDQRSAHLQLRRHLVASHE-KYCIPANQLITHRDTETRVEPWRSAKTG 109 ++S A P T+ + HL+ +R L+ + E K + + L+T TE +E WR ++ G Sbjct: 382 EFSEACHPYTSGRVGQHLKTKRGLITTPELKDLLDSGDLVTATATEKPIEEWRPSELG 439 >SB_29580| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-38) Length = 130 Score = 34.3 bits (75), Expect = 0.098 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 504 RSCIEKELFCNGKPDCKDESDENACTVELDPNRAP 608 R CI K C+GK DC DE C P P Sbjct: 54 RKCIRKSKICDGKSDCSGGEDEKNCVKPQTPPPTP 88 Score = 31.1 bits (67), Expect = 0.92 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENAC 578 C+++ C+G DC D SDE C Sbjct: 107 CVDRMKICDGMRDCADGSDERGC 129 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXN-QCVLPDCFC 650 CI + C+ + DC D SDE C+ ++ + C + +C+ C Sbjct: 16 CITRAFRCDDEDDCLDNSDEQGCSRKVCRDDQFQCGTSRKCIRKSKIC 63 >SB_56441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 34.3 bits (75), Expect = 0.098 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 510 CIEKELFCNGKPD-CKDESDENACTVELDPNRAPDCDXNQCVLPDCFC 650 C+ K CNG D C D SDE+ CT L + C +C+ FC Sbjct: 671 CVTKTSRCNGMRDSCVDGSDESGCTCGLHEFQ---CSSGECIEVATFC 715 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENAC 578 CIE FC+GK DC D DE C Sbjct: 708 CIEVATFCDGKKDCGDGFDETHC 730 >SB_51898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1712 Score = 34.3 bits (75), Expect = 0.098 Identities = 19/47 (40%), Positives = 23/47 (48%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCVLPDCFC 650 CI K C+G DC D+SDE C N+ CD QC+ D C Sbjct: 1321 CIPKMWRCDGMLDCTDKSDEEDCP-PCKENQF-RCDNGQCIDGDPRC 1365 Score = 31.5 bits (68), Expect = 0.69 Identities = 23/100 (23%), Positives = 45/100 (45%), Gaps = 1/100 (1%) Frame = +1 Query: 400 GKVNNCDKLEKPRKVLPILKTDEPICPEG-KLACGSGVALKKNCSVMVNQTAKMNPMKML 576 G++ + P + K + P+G AC +GV L ++ N+T + P L Sbjct: 426 GRLKLQSNVYSPMGIHVFEKARQDPLPKGISCACPTGVRL-----LLDNKTCENGPKHFL 480 Query: 577 ALSNWTQIERLTVXLTSASYLTVSVLLTVHVFQVEFDPIQ 696 L+ T + R+++ + + + + H V+FDPI+ Sbjct: 481 LLARRTDLRRISLDTPDHTDVVLPFVGIKHGIAVDFDPIE 520 >SB_35576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1315 Score = 34.3 bits (75), Expect = 0.098 Identities = 21/61 (34%), Positives = 26/61 (42%), Gaps = 5/61 (8%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCVLPDCFCSA-----DGTRIP 674 CI+ C+G DCKD SDE+ C + + C CV C DGT P Sbjct: 1167 CIDVVGLCDGTDDCKDASDESRCDHKCSKDEY-QCVSGACVKWPLTCDGKKDCEDGTDEP 1225 Query: 675 G 677 G Sbjct: 1226 G 1226 Score = 31.1 bits (67), Expect = 0.92 Identities = 12/29 (41%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = +3 Query: 507 SCIEKELFCNGKPDCKDESDE-NACTVEL 590 +C++ L C+GK DC+D +DE C V++ Sbjct: 1204 ACVKWPLTCDGKKDCEDGTDEPGICGVQI 1232 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCVLPDCFCSADGT 665 C+ ++L C+G C D SDE C L A C+ +C+ D DGT Sbjct: 1131 CVSRDLICDGDNACLDFSDEANCKC-LSSKFA--CESGECI--DVVGLCDGT 1177 >SB_21487| Best HMM Match : MAM (HMM E-Value=0) Length = 874 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNR 602 CI +L C+ DC D SDE C V+ DP R Sbjct: 716 CISLDLLCDFNKDCLDGSDEENCGVQ-DPGR 745 >SB_47789| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-34) Length = 262 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/50 (32%), Positives = 19/50 (38%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCVLPDCFCSAD 659 CI C+ DC D SDEN C CD +C+ C D Sbjct: 200 CIPSSWKCDHDNDCGDNSDENNCPYSTCNPSQFKCDNGRCISSKWRCDHD 249 >SB_58590| Best HMM Match : Polysacc_deac_1 (HMM E-Value=2.6e-08) Length = 893 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +3 Query: 603 APDCDXNQCVLPDCFCSADGTRIPGGI*P 689 A C + C LP+CFCS G +PGG+ P Sbjct: 566 AERCHPDVCKLPNCFCS--GALVPGGLNP 592 >SB_19614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 33.1 bits (72), Expect = 0.23 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 504 RSCIEKELFCNGKPDCKDESDENACTVE 587 R CI+ CN + DC+D SDE +C E Sbjct: 402 RQCIDDFKQCNNRQDCRDGSDEISCPPE 429 >SB_13477| Best HMM Match : Ldl_recept_a (HMM E-Value=0) Length = 628 Score = 33.1 bits (72), Expect = 0.23 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 504 RSCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQC 629 R C+ C+G+ DC D SDE C+ P P D +C Sbjct: 159 RRCVYNSQRCDGQNDCGDWSDETGCSTPPIPTTCP-ADWVRC 199 Score = 31.9 bits (69), Expect = 0.52 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDP 596 C+ L C+G DC D SDE +C P Sbjct: 115 CVFYRLVCDGVDDCGDSSDEMSCNATATP 143 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/51 (29%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDE-NACTVELDPNRAPDCDXNQCVLPDCFCSAD 659 CI C+G DC D SDE +C+ + C +C+ C D Sbjct: 22 CIPMSWRCDGDNDCGDMSDEPPSCSGRSCNSGQFSCSNGRCISRSWVCDRD 72 >SB_27746| Best HMM Match : MAM (HMM E-Value=1.4013e-45) Length = 622 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCVLPDCFCS 653 C+++ L C+G C D SDE C+ P+ C +C+ C+ Sbjct: 195 CVKRGLLCDGDKACLDGSDEKHCSC---PSNMFLCPSGECIPTTALCN 239 Score = 29.5 bits (63), Expect = 2.8 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENAC 578 CI CN + DC D +DE C Sbjct: 231 CIPTTALCNNENDCSDNADERNC 253 >SB_45605| Best HMM Match : MAM (HMM E-Value=2.1e-16) Length = 187 Score = 32.7 bits (71), Expect = 0.30 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENAC 578 C++++ CN K DC D SDE C Sbjct: 157 CVDRDQLCNFKDDCGDNSDELPC 179 >SB_4238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1288 Score = 32.7 bits (71), Expect = 0.30 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = +3 Query: 504 RSCIEKELFCNGKPDCKDESDENAC-TVELDPNRAPDCDXNQCVLPDCFCSAD 659 + CI C+G+ DC D SDE C +P+ C +C+ C D Sbjct: 597 QKCIAATWKCDGEDDCGDNSDEINCPKATCNPDTQFRCTNGRCIPRRWVCDKD 649 Score = 32.7 bits (71), Expect = 0.30 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENAC 578 CI K C+G+ DC ++SDEN C Sbjct: 759 CIHKSWVCDGEFDCLNKSDENNC 781 Score = 31.9 bits (69), Expect = 0.52 Identities = 16/51 (31%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDE-NACTVELDPNRAPDCDXNQCVLPDCFCSAD 659 CI + C+ DC D SDE N+C C CV+ C D Sbjct: 639 CIPRRWVCDKDDDCHDGSDERNSCATMTCSENEITCGNGICVVKRWVCDQD 689 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/50 (28%), Positives = 19/50 (38%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCVLPDCFCSAD 659 C+ K C+ DC D +DE C C +C+L C D Sbjct: 679 CVVKRWVCDQDDDCGDGTDELNCAPHTCRPNEFTCADKRCILSRWRCDGD 728 Score = 29.5 bits (63), Expect = 2.8 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +3 Query: 504 RSCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXN--QCVLPDC 644 + CI C+G DC D SDE C PN + C + QC +C Sbjct: 716 KRCILSRWRCDGDRDCADNSDEINC-----PNSSQYCKSSEYQCSTGEC 759 >SB_27121| Best HMM Match : CBM_14 (HMM E-Value=5.8e-29) Length = 339 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 346 TCPSGLAFDLDKQTCDWKGKVNNCD 420 +CPSGL + + K TCDW V +CD Sbjct: 145 SCPSGLKWSVTKTTCDWPRYV-DCD 168 >SB_27119| Best HMM Match : CBM_14 (HMM E-Value=4.1e-15) Length = 220 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 346 TCPSGLAFDLDKQTCDWKGKVNNCD 420 +CPSGL + + K TCDW V +CD Sbjct: 52 SCPSGLKWSVTKTTCDWPRYV-DCD 75 >SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) Length = 1120 Score = 31.9 bits (69), Expect = 0.52 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACT 581 CI L C+G DC D SDE CT Sbjct: 35 CIPDVLKCDGSEDCADSSDEINCT 58 >SB_43832| Best HMM Match : CBM_14 (HMM E-Value=2.8e-16) Length = 518 Score = 31.5 bits (68), Expect = 0.69 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 346 TCPSGLAFDLDKQTCDWKGKV 408 TCP GL F+ D CDW +V Sbjct: 487 TCPPGLIFNTDLMVCDWSHEV 507 >SB_24224| Best HMM Match : Lectin_C (HMM E-Value=0) Length = 2726 Score = 31.1 bits (67), Expect = 0.92 Identities = 22/82 (26%), Positives = 34/82 (41%), Gaps = 1/82 (1%) Frame = +3 Query: 438 KSFTNLENGRTYLS*R*IGLWQRSCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCD 617 ++FTN+E+ Y + G W+ S K ++ + KD+ D V LD D Sbjct: 1383 ENFTNIESWLGYRDQKAAGTWRWSDGSKSVYTDWDSSAKDDHDLGMDCVVLDAEEGKWRD 1442 Query: 618 XNQCVLPDCF-CSADGTRIPGG 680 + C + F C D P G Sbjct: 1443 -SSCAEKNSFLCKRDADDCPSG 1463 >SB_44732| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 675 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 9/50 (18%) Frame = +1 Query: 409 NNCDKLEKPRKVLPILKTDEPICPEG--------KLACGSGVALKK-NCS 531 NNCD KP + +LK + P+CP+ L CG GV ++ +CS Sbjct: 141 NNCDTARKPTQ---LLKCELPVCPQWNAGDWGQCSLTCGGGVQTRRIDCS 187 >SB_6273| Best HMM Match : MAM (HMM E-Value=0) Length = 4272 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTV 584 CI+K C+ DC D SDE C + Sbjct: 3216 CIQKSKLCDFTDDCGDNSDEGRCAL 3240 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 507 SCIEKELFCNGKPDCKDESDENAC 578 SCI+ C+ DC D SDEN C Sbjct: 2104 SCIDTGRVCDFTDDCGDNSDENNC 2127 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 507 SCIEKELFCNGKPDCKDESDENACT 581 SC + C+ DC D SDE +C+ Sbjct: 3631 SCTSSDNVCDFSDDCGDSSDERSCS 3655 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 507 SCIEKELFCNGKPDCKDESDENAC 578 SCI + L C+ + DC D DE +C Sbjct: 2257 SCIMQSLRCDYQNDCSDGLDEASC 2280 >SB_50657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENAC 578 CI L C+ DC DESDE C Sbjct: 17 CISGALVCDLDDDCGDESDERGC 39 >SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1671 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 349 CPSGLAFDLDKQTCDWKGKVN 411 CP L FD K C+W KVN Sbjct: 627 CPFNLKFDTKKLECEWPNKVN 647 >SB_641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 530 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 597 NRAPDCDXNQCVLPDCFCSADGTRIPGGI*P 689 N A CD +C P+C CS D + PGG+ P Sbjct: 25 NVAEKCDLEKCQPPNCRCS-DDFQPPGGLSP 54 >SB_35350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 626 Score = 29.5 bits (63), Expect = 2.8 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +3 Query: 504 RSCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXN--QCVLPDC 644 + CI C+G DC D SDE C PN + C + QC +C Sbjct: 561 KRCILSRWRCDGDRDCADNSDEINC-----PNSSQYCKSSEYQCSTGEC 604 >SB_26236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 736 Score = 29.5 bits (63), Expect = 2.8 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +3 Query: 555 DESDENACTVELDPNRAPDCDXNQCV 632 D+ D+ C +P++ PD D ++CV Sbjct: 410 DQGDQGECVTVPEPDQVPDSDRDECV 435 >SB_13199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 29.5 bits (63), Expect = 2.8 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENAC 578 C+ + C+G DC D SDE C Sbjct: 33 CVPRTWLCDGDNDCHDGSDEKNC 55 >SB_31927| Best HMM Match : Ldl_recept_a (HMM E-Value=2.3e-27) Length = 157 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 507 SCIEKELFCNGKPDCKDESDENACT 581 +CI + C+ DC D SDE AC+ Sbjct: 11 NCINRNYVCDKDNDCGDGSDEVACS 35 >SB_24031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1176 Score = 29.1 bits (62), Expect = 3.7 Identities = 23/70 (32%), Positives = 33/70 (47%) Frame = -3 Query: 697 LELGQIPPGIRVPSAEQKQSGRTHWLXSQSGALFGSSSTVQAFSSDSSLQSGLPLQNNSF 518 L+ Q P R P Q+Q R H+L +QS + + VQ SSD++ S Q F Sbjct: 584 LQQQQSAPETRPPQQPQQQ--REHYLQNQSLNVTNTQMPVQQGSSDNTQVS----QTGDF 637 Query: 517 SMQLRCHKPI 488 Q+ +PI Sbjct: 638 QAQIETVEPI 647 >SB_23898| Best HMM Match : Ldl_recept_a (HMM E-Value=1.4013e-45) Length = 291 Score = 29.1 bits (62), Expect = 3.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENAC 578 C+ + C+G DC+D +DE C Sbjct: 109 CVHRNWKCDGSNDCRDGTDEVGC 131 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 507 SCIEKELFCNGKPDCKDESDENACT 581 +CI + C+ DC D SDE AC+ Sbjct: 145 NCINRNYVCDKDNDCGDGSDEVACS 169 >SB_40871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 28.3 bits (60), Expect = 6.5 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 531 CNGKPDCKDESDENAC 578 C+G+ DC+D SDE C Sbjct: 100 CDGENDCRDGSDETGC 115 >SB_30805| Best HMM Match : Neur_chan_LBD (HMM E-Value=2.9e-06) Length = 147 Score = 28.3 bits (60), Expect = 6.5 Identities = 19/79 (24%), Positives = 33/79 (41%) Frame = +1 Query: 406 VNNCDKLEKPRKVLPILKTDEPICPEGKLACGSGVALKKNCSVMVNQTAKMNPMKMLALS 585 +NN DK + + KTD + GK+ + + +C + V + L S Sbjct: 35 INNADKSVRLAGGPELFKTDLNVWQGGKVEWVAPASFTSDCKLRVRYWPIDDQFCTLTFS 94 Query: 586 NWTQIERLTVXLTSASYLT 642 +WT ++ + T S LT Sbjct: 95 SWTYDDQEIIIETDDSELT 113 >SB_2014| Best HMM Match : MAM (HMM E-Value=0) Length = 2282 Score = 28.3 bits (60), Expect = 6.5 Identities = 18/53 (33%), Positives = 23/53 (43%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDXNQCVLPDCFCSADGTR 668 CI C+G +C D SDE+ C + N C +CV C DG R Sbjct: 221 CISGSSRCDGDYNCMDRSDEDGC--KCFTNEL-TCSSGRCVQSINLC--DGVR 268 >SB_35754| Best HMM Match : DUF755 (HMM E-Value=2.4) Length = 604 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -1 Query: 672 EYVYRQQNRNSQVGRTG*XHSQALYLGPVRQC 577 E + + +N +GRTG S + Y GP+ +C Sbjct: 457 EIILKSENEFPLIGRTGSGSSISKYTGPLMEC 488 >SB_33423| Best HMM Match : Ldl_recept_a (HMM E-Value=7.8e-22) Length = 133 Score = 27.9 bits (59), Expect = 8.5 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTV 584 C+ K C+ DC D SDE C + Sbjct: 101 CLAKSSLCDTVHDCDDGSDEKNCPI 125 >SB_31087| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-32) Length = 1039 Score = 27.9 bits (59), Expect = 8.5 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 510 CIEKELFCNGKPDCKDESDENACTV 584 C+ K C+ DC D SDE C + Sbjct: 914 CLAKSSLCDTVHDCDDGSDEKNCPI 938 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,972,355 Number of Sequences: 59808 Number of extensions: 454326 Number of successful extensions: 1471 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 1253 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1470 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -