BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30392 (708 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 2.8 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 3.7 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.0 bits (47), Expect = 2.8 Identities = 23/85 (27%), Positives = 35/85 (41%) Frame = -3 Query: 610 SGALFGSSSTVQAFSSDSSLQSGLPLQNNSFSMQLRCHKPIYLQDK*VRPFSRLVKLFVA 431 SG+L S + +SS SG ++ + ++ R + LQ S L Sbjct: 238 SGSLPASPADSGVSDVESSTSSG-GNEDANLLLKARLNPNSSLQPSLASHHSHLSSALGR 296 Query: 430 SRVCHSCSLYPSSRRFVYQDRKPIQ 356 S CHS +YPS+ F+ P Q Sbjct: 297 S-ACHSPGVYPSTAGFLPPSYHPHQ 320 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -1 Query: 273 SSAGLPCTTDQRSAHLQLRRHLVASHEKY 187 S GL TTD S ++ LRRH + Y Sbjct: 222 SKFGLGFTTDLLSYNILLRRHYSMNSTTY 250 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,364 Number of Sequences: 438 Number of extensions: 4056 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -