BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30390 (611 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 29 0.023 AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 27 0.16 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 27 0.16 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 23 1.5 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 29.5 bits (63), Expect = 0.023 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +3 Query: 3 FNGKELNKSINPDE 44 F+GKELN+ INPDE Sbjct: 181 FDGKELNRGINPDE 194 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 26.6 bits (56), Expect = 0.16 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 3 FNGKELNKSINPDE 44 FNGKE +SINPDE Sbjct: 182 FNGKEPCRSINPDE 195 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 26.6 bits (56), Expect = 0.16 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 3 FNGKELNKSINPDE 44 FNGKE +SINPDE Sbjct: 182 FNGKEPCRSINPDE 195 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 23.4 bits (48), Expect = 1.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +2 Query: 317 FELTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKSTNK 433 + G+ A V I+ D+D NG N + ++K+ K Sbjct: 56 YSFIGVNDADWSVLVIDPELDVDQNGFRNFTNLKKTHPK 94 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,794 Number of Sequences: 336 Number of extensions: 2599 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15561709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -