BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30390 (611 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 23 3.1 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 22 4.1 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 5.4 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 7.2 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 7.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 7.2 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 22.6 bits (46), Expect = 3.1 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = -1 Query: 254 SGLVIRVGGECLSLFSGDGSVTLDECGHDTSSSLNTEGKGCY 129 SG +I G+ + +++ +G L +S S+NT+ G Y Sbjct: 342 SGYLIDEYGKKIDIYTPEGLNMLGNVIEGSSDSINTKFYGMY 383 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 22.2 bits (45), Expect = 4.1 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = -1 Query: 254 SGLVIRVGGECLSLFSGDGSVTLDECGHDTSSSLNTEGKGCY 129 SG +I G+ + +++ +G L S S+NT+ G Y Sbjct: 342 SGYLIDEYGKKIDIYTPEGLNMLGNVIEGNSDSINTKFYGMY 383 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.8 bits (44), Expect = 5.4 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 388 QRYPQRFRYREVHQ-QGEQDHHYQRQRSSLQGRDR 489 +RY R R RE + + E+++ R+RS + RDR Sbjct: 270 KRY-SRSREREQNSYKNEREYRKYRERSKERSRDR 303 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.4 bits (43), Expect = 7.2 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -3 Query: 282 RSPSNTWMSIRVGYQSRW 229 R P N W+S+ G +W Sbjct: 158 RQPPNNWLSVFWGSAWQW 175 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.4 bits (43), Expect = 7.2 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -3 Query: 351 PRGAGGIPVS 322 PRG GG+P S Sbjct: 399 PRGPGGVPTS 408 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 190 VTLPSPLNRLRHSPP 234 +T PSP R R++PP Sbjct: 986 MTDPSPFKRGRYTPP 1000 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,510 Number of Sequences: 438 Number of extensions: 3401 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18093444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -