BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30389 (724 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 24 4.1 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 24 4.1 Y17717-1|CAA76832.1| 101|Anopheles gambiae cE5 protein protein. 23 7.2 AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-... 23 9.6 AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 23 9.6 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 24.2 bits (50), Expect = 4.1 Identities = 22/69 (31%), Positives = 25/69 (36%), Gaps = 2/69 (2%) Frame = +3 Query: 267 PAEAHRDSGEEPASGQRRCRSGESPPEPLGRS*TLRQDSDEAHDDGRKESTAP--DRSYR 440 PA D+ G+ G S G + D DE H GRK AP R Sbjct: 616 PAGYREDTTGSYKYGKLSSSGGASSTTHSGAPSRSQSDEDEQHSVGRK-GLAPLIQRGEG 674 Query: 441 SGEGKEQIP 467 S EGK P Sbjct: 675 SFEGKAMPP 683 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 24.2 bits (50), Expect = 4.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 200 QTEAQSFHWCRRHGD 156 QT +Q+ HW + HGD Sbjct: 222 QTLSQANHWLKSHGD 236 >Y17717-1|CAA76832.1| 101|Anopheles gambiae cE5 protein protein. Length = 101 Score = 23.4 bits (48), Expect = 7.2 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 469 NGIENFDPTKLKHRKRARRTRSPQRTSLSKRN 564 +G E FDP+ L+ A R P R RN Sbjct: 53 DGEEEFDPSLLEEHADAPTARDPGRNPEFLRN 84 >AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-A-gated chloride channelprotein. Length = 459 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = -2 Query: 501 QLSGIEVLDAVQEFVLFLLRFDSFDRGQWILF 406 ++ + V+D V+F + F +F+ G WI + Sbjct: 426 KIKDVNVIDKYSR-VIFPVSFAAFNAGYWIFY 456 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -2 Query: 384 LSLVEVFNSVQEVLVGFLRCDNV 316 LS ++ +S+ +L+G RCD V Sbjct: 108 LSRPQMRSSINYLLIGLARCDTV 130 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 729,485 Number of Sequences: 2352 Number of extensions: 14273 Number of successful extensions: 34 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -