BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30386 (713 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1711.06 |rpl401|rpl4-1, rpl4|60S ribosomal protein L2|Schizo... 26 6.1 SPBP4H10.09 |rsv1||transcription factor Rsv1 |Schizosaccharomyce... 26 6.1 SPBP8B7.03c |rpl402|rpl4-2, rpl4|60S ribosomal protein L2|Schizo... 26 6.1 SPAC1A6.02 ||SPAC23C4.21|WD repeat protein, human WDR55 family|S... 26 6.1 >SPBC1711.06 |rpl401|rpl4-1, rpl4|60S ribosomal protein L2|Schizosaccharomyces pombe|chr 2|||Manual Length = 363 Score = 25.8 bits (54), Expect = 6.1 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 611 WYIKNNQNRSRFPIPEQITFPGV 679 W++K NQN R+ I + GV Sbjct: 111 WHVKVNQNEKRYAIASAVAASGV 133 >SPBP4H10.09 |rsv1||transcription factor Rsv1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 428 Score = 25.8 bits (54), Expect = 6.1 Identities = 15/48 (31%), Positives = 27/48 (56%) Frame = +1 Query: 124 NTGDILFALSLDLLSIRWTRRD*LVKNILLTSLDFSLITADATARIGI 267 +TG+ F S R+TRRD L++++ T L +L+T + T + + Sbjct: 26 HTGEKPFECSYPSCKKRFTRRDELIRHV-RTHLRKALVTPEQTLDVNL 72 >SPBP8B7.03c |rpl402|rpl4-2, rpl4|60S ribosomal protein L2|Schizosaccharomyces pombe|chr 2|||Manual Length = 363 Score = 25.8 bits (54), Expect = 6.1 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 611 WYIKNNQNRSRFPIPEQITFPGV 679 W++K NQN R+ I + GV Sbjct: 111 WHVKVNQNEKRYAISSAVAASGV 133 >SPAC1A6.02 ||SPAC23C4.21|WD repeat protein, human WDR55 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 361 Score = 25.8 bits (54), Expect = 6.1 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +1 Query: 616 HKKQSKSIQIPDSGTNYLSRG 678 HKK ++I + +SGT ++S G Sbjct: 58 HKKSCRNISVNESGTEFISVG 78 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,523,707 Number of Sequences: 5004 Number of extensions: 43761 Number of successful extensions: 103 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 333194204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -