BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30386 (713 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0749 + 5599238-5600128 30 1.6 07_01_0935 + 7905748-7905765,7906071-7906096,7906142-7906166,790... 29 4.8 08_02_0716 + 20364848-20364978,20365011-20365230 28 8.5 >06_01_0749 + 5599238-5600128 Length = 296 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 422 VYYKIKYLRTQYQQRPPAHSNTTIHKRKPR 333 VYYK+K ++++ PP + TT H R+ R Sbjct: 145 VYYKLKRNKSKFLHAPPQATTTTPHDRRVR 174 >07_01_0935 + 7905748-7905765,7906071-7906096,7906142-7906166, 7906891-7907700,7907803-7907934,7908102-7908470, 7908540-7908671,7909135-7909662 Length = 679 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 273 AVYYKNIKPTKERDSNYFCITWFSFMYCSV 362 A+ + + +P D +Y C W S+ YC V Sbjct: 392 AISHTSPQPVDRSDLSYICFKWSSYGYCLV 421 >08_02_0716 + 20364848-20364978,20365011-20365230 Length = 116 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 294 KPTKERDSNYFCITWFSFMYCSVAVCRRSLL 386 +P D +Y C W S+ YC V R S++ Sbjct: 72 QPVDRSDLSYICFKWSSYDYCLVLDQRCSVI 102 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,527,574 Number of Sequences: 37544 Number of extensions: 253065 Number of successful extensions: 442 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 431 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 442 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -