BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30383 (658 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 27 0.12 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 1.1 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 21 7.8 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 27.5 bits (58), Expect = 0.12 Identities = 18/70 (25%), Positives = 30/70 (42%), Gaps = 1/70 (1%) Frame = +2 Query: 155 EKPPPEPFNDGKTQSDHTDDEEKEDIVNIPNLRD-TQKVFHALHHRSCEDMKLTKIRNLM 331 E PPP P N + S D +E +I RD + ++ R + M ++R L+ Sbjct: 1858 EPPPPPPRNHDQNNSSFNDSKESNEISEAECDRDQLVNRNYGVNARGKDGMTTEEMRKLI 1917 Query: 332 KFREKSRMRT 361 + E +T Sbjct: 1918 ERNEAPSRQT 1927 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 179 NDGKTQSDHTDDEEKED 229 NDG+ D DDEE E+ Sbjct: 272 NDGEGADDRDDDEENEE 288 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.4 bits (43), Expect = 7.8 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 6 QEFGTRKSVSIPRKENNDKLPKKPE 80 QE + V PR++NN L KPE Sbjct: 330 QEERRSEPVEPPRRKNNCPLHCKPE 354 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,072 Number of Sequences: 438 Number of extensions: 3476 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -