BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30380 (710 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 26 0.35 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 24 1.4 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 22 5.7 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 9.9 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 25.8 bits (54), Expect = 0.35 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 512 NDRPVKDVVISDTETEVVAEPFSVTKESAH 601 ND+ VKD+VI ET +++ F++ + H Sbjct: 644 NDKAVKDLVILLFETALLSSGFTLDEPQVH 673 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.8 bits (49), Expect = 1.4 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 364 IDNQPAP*CFSLKFSSSKRSPYI 296 + NQ + CFSLK + K P++ Sbjct: 517 LGNQNSEMCFSLKLKNKKLPPFL 539 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/51 (21%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +1 Query: 109 DNIGTIVIGLFGKTVPKTTENFFQLAQKPEGEGYKGSKFHRVIK-NFMIQV 258 DNI +I + K + + + +K E ++ FH++ K ++++V Sbjct: 124 DNIVKPIIAFYYKPIKTLNGHEIKFIRKEEYISFESKVFHKLKKMKYLVEV 174 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.0 bits (42), Expect = 9.9 Identities = 9/29 (31%), Positives = 13/29 (44%) Frame = -1 Query: 671 PWESW*RHSSWKLLIIRTFIIKFSEHSLW 585 PW++ H W+ L + I E LW Sbjct: 527 PWQTVYNHRPWQQLHLNKKQILGGEACLW 555 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,033 Number of Sequences: 336 Number of extensions: 3424 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18843005 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -