BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30377 (717 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2G11.11c |prh1||ATP-dependent RNA helicase Prh1|Schizosaccha... 26 6.2 >SPAC2G11.11c |prh1||ATP-dependent RNA helicase Prh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 719 Score = 25.8 bits (54), Expect = 6.2 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = -1 Query: 300 INAKNILL*YLHLQETTRVLYHPKG--RLVLHPTEVSISNNTSARTSQKAVCVQHTL 136 +N++N+LL +L T L HP G R ++ +SI ++S + + H L Sbjct: 631 VNSENLLLSFLSGYITNTALLHPDGSYRTIIGNQTISIHPSSSLFGKKVEAIMYHEL 687 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,522,293 Number of Sequences: 5004 Number of extensions: 45923 Number of successful extensions: 71 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -