Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30377
         (717 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g33020.1 68417.m04697 metal transporter, putative (ZIP9) iden...    28   5.4  

>At4g33020.1 68417.m04697 metal transporter, putative (ZIP9)
           identical to putative metal transporter ZIP9
           [Arabidopsis thaliana] gi|17385790|gb|AAL38435; similar
           to Zn and Cd transporter ZNT1 [Thlaspi caerulescens]
           gi|7381054|gb|AAF61374; member of the Zinc (Zn2+)-Iron
           (Fe2+) permease (ZIP) family, PMID:11500563
          Length = 344

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%)
 Frame = +3

Query: 192 LSIPRSGATLIDL*DGIIRGSSPVSEGIIIVY-FWH*FSGG 311
           +SIP  G TL+ L  G++RG+   + G+I+   F H  SGG
Sbjct: 12  VSIPLVG-TLLPLNGGLMRGAKAFAAGVILATGFVHMLSGG 51


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,738,943
Number of Sequences: 28952
Number of extensions: 227152
Number of successful extensions: 404
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 401
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 404
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1555552968
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)