BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30374 (710 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 52 3e-07 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_5774| Best HMM Match : TLD (HMM E-Value=2.2e-07) 51 8e-07 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 51 8e-07 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 51 8e-07 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 50 1e-06 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 50 2e-06 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 50 2e-06 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 49 3e-06 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_29661| Best HMM Match : DUF872 (HMM E-Value=8.6) 49 3e-06 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 49 4e-06 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 49 4e-06 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 49 4e-06 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 49 4e-06 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 49 4e-06 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 49 4e-06 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 49 4e-06 SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 49 4e-06 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 48 6e-06 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 48 6e-06 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 48 6e-06 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 48 6e-06 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 48 6e-06 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 48 6e-06 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_20200| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 48 6e-06 SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 48 8e-06 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 48 8e-06 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 48 8e-06 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_17505| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 48 8e-06 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 48 8e-06 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 48 8e-06 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 48 1e-05 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 48 1e-05 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 48 1e-05 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 48 1e-05 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 48 1e-05 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 48 1e-05 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 48 1e-05 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 48 1e-05 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 48 1e-05 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 48 1e-05 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 48 1e-05 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 48 1e-05 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 48 1e-05 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 48 1e-05 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 48 1e-05 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 48 1e-05 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 48 1e-05 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 48 1e-05 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 48 1e-05 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 48 1e-05 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 48 1e-05 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 48 1e-05 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 48 1e-05 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 48 1e-05 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 48 1e-05 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 48 1e-05 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 48 1e-05 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 48 1e-05 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 48 1e-05 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 48 1e-05 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 48 1e-05 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 53.6 bits (123), Expect = 2e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 HLV NSCSPGDPLVLERPPPRW Sbjct: 23 HLVSNSCSPGDPLVLERPPPRW 44 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 53.6 bits (123), Expect = 2e-07 Identities = 31/66 (46%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Frame = -3 Query: 198 MTRSTGLSTRCILRYMDAS-ENPCWLVLNASDHMYP*ARAGSTLHLVPNSCSPGDPLVLE 22 MT S +S L YM +S E W L Y +G + ++ NSCSPGDPLVLE Sbjct: 61 MTSSYNVSGWSTLYYMTSSYEVSGWSTLYYMTSSY--GVSGWSTFILSNSCSPGDPLVLE 118 Query: 21 RPPPRW 4 RPPPRW Sbjct: 119 RPPPRW 124 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -3 Query: 96 P*ARAGSTLHLVPNSCSPGDPLVLERPPPRW 4 P +R+ ++ L+ NSCSPGDPLVLERPPPRW Sbjct: 23 PPSRSTVSISLISNSCSPGDPLVLERPPPRW 53 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -3 Query: 96 P*ARAGSTLHLVPNSCSPGDPLVLERPPPRW 4 P +R+ ++ L+ NSCSPGDPLVLERPPPRW Sbjct: 23 PPSRSTVSISLISNSCSPGDPLVLERPPPRW 53 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -3 Query: 96 P*ARAGSTLHLVPNSCSPGDPLVLERPPPRW 4 P +R+ ++ L+ NSCSPGDPLVLERPPPRW Sbjct: 23 PPSRSTVSISLISNSCSPGDPLVLERPPPRW 53 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -3 Query: 96 P*ARAGSTLHLVPNSCSPGDPLVLERPPPRW 4 P +R+ ++ L+ NSCSPGDPLVLERPPPRW Sbjct: 23 PPSRSTVSISLISNSCSPGDPLVLERPPPRW 53 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -3 Query: 96 P*ARAGSTLHLVPNSCSPGDPLVLERPPPRW 4 P +R+ ++ L+ NSCSPGDPLVLERPPPRW Sbjct: 23 PPSRSTVSISLISNSCSPGDPLVLERPPPRW 53 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 53.2 bits (122), Expect = 2e-07 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 HL+ NSCSPGDPLVLERPPPRW Sbjct: 39 HLISNSCSPGDPLVLERPPPRW 60 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -3 Query: 96 P*ARAGSTLHLVPNSCSPGDPLVLERPPPRW 4 P +R+ ++ L+ NSCSPGDPLVLERPPPRW Sbjct: 23 PPSRSTVSISLISNSCSPGDPLVLERPPPRW 53 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -3 Query: 96 P*ARAGSTLHLVPNSCSPGDPLVLERPPPRW 4 P +R+ ++ L+ NSCSPGDPLVLERPPPRW Sbjct: 23 PPSRSTVSISLISNSCSPGDPLVLERPPPRW 53 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 53.2 bits (122), Expect = 2e-07 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -3 Query: 96 P*ARAGSTLHLVPNSCSPGDPLVLERPPPRW 4 P +R+ ++ L+ NSCSPGDPLVLERPPPRW Sbjct: 21 PPSRSTVSISLISNSCSPGDPLVLERPPPRW 51 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 52.4 bits (120), Expect = 3e-07 Identities = 21/31 (67%), Positives = 25/31 (80%) Frame = -3 Query: 96 P*ARAGSTLHLVPNSCSPGDPLVLERPPPRW 4 P R+ ++ L+ NSCSPGDPLVLERPPPRW Sbjct: 24 PLLRSTVSISLISNSCSPGDPLVLERPPPRW 54 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 52.4 bits (120), Expect = 3e-07 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -3 Query: 84 AGSTLHLVPNSCSPGDPLVLERPPPRW 4 AG + + NSCSPGDPLVLERPPPRW Sbjct: 45 AGDVIAFISNSCSPGDPLVLERPPPRW 71 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 52.4 bits (120), Expect = 3e-07 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 1/26 (3%) Frame = -3 Query: 78 STLHLVP-NSCSPGDPLVLERPPPRW 4 +TL LVP NSCSPGDPLVLERPPPRW Sbjct: 23 TTLPLVPSNSCSPGDPLVLERPPPRW 48 >SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 52.4 bits (120), Expect = 3e-07 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -3 Query: 75 TLHLVPNSCSPGDPLVLERPPPRW 4 T+H NSCSPGDPLVLERPPPRW Sbjct: 29 TIHSASNSCSPGDPLVLERPPPRW 52 >SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 52.0 bits (119), Expect = 5e-07 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 +H++ NSCSPGDPLVLERPPPRW Sbjct: 21 IHVLSNSCSPGDPLVLERPPPRW 43 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 51.6 bits (118), Expect = 6e-07 Identities = 23/34 (67%), Positives = 26/34 (76%), Gaps = 1/34 (2%) Frame = -3 Query: 102 MYP*ARAGSTLHLVP-NSCSPGDPLVLERPPPRW 4 ++P A LH+ P NSCSPGDPLVLERPPPRW Sbjct: 3 LHPDACLVMVLHVPPSNSCSPGDPLVLERPPPRW 36 >SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 51.6 bits (118), Expect = 6e-07 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -3 Query: 99 YP*ARAGSTLHLVPNSCSPGDPLVLERPPPRW 4 YP + S H NSCSPGDPLVLERPPPRW Sbjct: 15 YP--KRNSNSHTASNSCSPGDPLVLERPPPRW 44 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 51.6 bits (118), Expect = 6e-07 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 ++L+ NSCSPGDPLVLERPPPRW Sbjct: 6 IYLISNSCSPGDPLVLERPPPRW 28 >SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 51.6 bits (118), Expect = 6e-07 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = -3 Query: 99 YP*ARAGSTLHLVPNSCSPGDPLVLERPPPRW 4 YP R + + NSCSPGDPLVLERPPPRW Sbjct: 23 YPAVRTQKPVIFLSNSCSPGDPLVLERPPPRW 54 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = -3 Query: 87 RAGSTLHLVPNSCSPGDPLVLERPPPRW 4 RA + ++ NSCSPGDPLVLERPPPRW Sbjct: 112 RAKNQKEIISNSCSPGDPLVLERPPPRW 139 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 L L+ NSCSPGDPLVLERPPPRW Sbjct: 35 LDLISNSCSPGDPLVLERPPPRW 57 >SB_5774| Best HMM Match : TLD (HMM E-Value=2.2e-07) Length = 318 Score = 51.2 bits (117), Expect = 8e-07 Identities = 27/69 (39%), Positives = 39/69 (56%), Gaps = 3/69 (4%) Frame = +2 Query: 50 QEFG---TRCSVLPARAQGYMWSLAFSTSQHGFSLASMYRKMQRVDSPVLLVIQDTDNNV 220 +EFG TR L G W L +ST HG SL ++Y ++Q V +P++LVI+D+ V Sbjct: 204 REFGDSSTRQRKLSEFVPGNAWILLYSTFTHGISLKTLYYRLQDVQTPIMLVIKDSQGYV 263 Query: 221 FGAMTSCAL 247 FG + L Sbjct: 264 FGVYSPVPL 272 >SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 HL NSCSPGDPLVLERPPPRW Sbjct: 26 HLPSNSCSPGDPLVLERPPPRW 47 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 LH+ NSCSPGDPLVLERPPPRW Sbjct: 51 LHVRSNSCSPGDPLVLERPPPRW 73 >SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) Length = 736 Score = 51.2 bits (117), Expect = 8e-07 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 +H + NSCSPGDPLVLERPPPRW Sbjct: 609 VHFLSNSCSPGDPLVLERPPPRW 631 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 L L+ NSCSPGDPLVLERPPPRW Sbjct: 19 LFLISNSCSPGDPLVLERPPPRW 41 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 51.2 bits (117), Expect = 8e-07 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -3 Query: 78 STLHLVPNSCSPGDPLVLERPPPRW 4 ++L L NSCSPGDPLVLERPPPRW Sbjct: 657 NSLQLASNSCSPGDPLVLERPPPRW 681 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = -3 Query: 99 YP*ARAGSTLHLVPNSCSPGDPLVLERPPPRW 4 +P +R S L + NSCSPGDPLVLERPPPRW Sbjct: 141 FPYSR-NSRLEKISNSCSPGDPLVLERPPPRW 171 >SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = -3 Query: 78 STLHLVPNSCSPGDPLVLERPPPRW 4 S LH NSCSPGDPLVLERPPPRW Sbjct: 15 SGLHSGSNSCSPGDPLVLERPPPRW 39 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = -3 Query: 81 GSTLHLVPNSCSPGDPLVLERPPPRW 4 GS+ + NSCSPGDPLVLERPPPRW Sbjct: 2416 GSSSAIASNSCSPGDPLVLERPPPRW 2441 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 50.8 bits (116), Expect = 1e-06 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = -3 Query: 75 TLHLVPNSCSPGDPLVLERPPPRW 4 T+ ++ NSCSPGDPLVLERPPPRW Sbjct: 2 TIVIISNSCSPGDPLVLERPPPRW 25 >SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -3 Query: 84 AGSTLHLVPNSCSPGDPLVLERPPPRW 4 +G H + NSCSPGDPLVLERPPPRW Sbjct: 78 SGLNEHSLSNSCSPGDPLVLERPPPRW 104 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -3 Query: 81 GSTLHLVPNSCSPGDPLVLERPPPRW 4 G+ H NSCSPGDPLVLERPPPRW Sbjct: 54 GTVTHRRSNSCSPGDPLVLERPPPRW 79 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -3 Query: 75 TLHLVPNSCSPGDPLVLERPPPRW 4 T +V NSCSPGDPLVLERPPPRW Sbjct: 82 TQRIVSNSCSPGDPLVLERPPPRW 105 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 50.8 bits (116), Expect = 1e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = -3 Query: 78 STLHLVPNSCSPGDPLVLERPPPRW 4 S L L NSCSPGDPLVLERPPPRW Sbjct: 84 SNLLLTSNSCSPGDPLVLERPPPRW 108 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 HL NSCSPGDPLVLERPPPRW Sbjct: 212 HLRSNSCSPGDPLVLERPPPRW 233 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 LV NSCSPGDPLVLERPPPRW Sbjct: 3 LVSNSCSPGDPLVLERPPPRW 23 >SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -3 Query: 81 GSTLHLVPNSCSPGDPLVLERPPPRW 4 G + + NSCSPGDPLVLERPPPRW Sbjct: 12 GKSFRVTSNSCSPGDPLVLERPPPRW 37 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 LV NSCSPGDPLVLERPPPRW Sbjct: 17 LVSNSCSPGDPLVLERPPPRW 37 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 50.4 bits (115), Expect = 1e-06 Identities = 22/28 (78%), Positives = 23/28 (82%), Gaps = 1/28 (3%) Frame = -3 Query: 84 AGSTLHL-VPNSCSPGDPLVLERPPPRW 4 + ST H V NSCSPGDPLVLERPPPRW Sbjct: 24 SNSTPHFRVSNSCSPGDPLVLERPPPRW 51 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 LV NSCSPGDPLVLERPPPRW Sbjct: 9 LVSNSCSPGDPLVLERPPPRW 29 >SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 +H NSCSPGDPLVLERPPPRW Sbjct: 11 IHRASNSCSPGDPLVLERPPPRW 33 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 LV NSCSPGDPLVLERPPPRW Sbjct: 5 LVSNSCSPGDPLVLERPPPRW 25 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = -3 Query: 75 TLHLVPNSCSPGDPLVLERPPPRW 4 T+ ++ NSCSPGDPLVLERPPPRW Sbjct: 62 TVFMLSNSCSPGDPLVLERPPPRW 85 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 LV NSCSPGDPLVLERPPPRW Sbjct: 2 LVSNSCSPGDPLVLERPPPRW 22 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 LV NSCSPGDPLVLERPPPRW Sbjct: 26 LVSNSCSPGDPLVLERPPPRW 46 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 LV NSCSPGDPLVLERPPPRW Sbjct: 26 LVSNSCSPGDPLVLERPPPRW 46 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 50.4 bits (115), Expect = 1e-06 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -3 Query: 84 AGSTLHLVPNSCSPGDPLVLERPPPRW 4 + + + L+ NSCSPGDPLVLERPPPRW Sbjct: 10 SANIVFLISNSCSPGDPLVLERPPPRW 36 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -3 Query: 84 AGSTLHLVPNSCSPGDPLVLERPPPRW 4 AG+T NSCSPGDPLVLERPPPRW Sbjct: 176 AGTTTIPPSNSCSPGDPLVLERPPPRW 202 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/24 (87%), Positives = 22/24 (91%), Gaps = 1/24 (4%) Frame = -3 Query: 72 LH-LVPNSCSPGDPLVLERPPPRW 4 LH +V NSCSPGDPLVLERPPPRW Sbjct: 344 LHSIVSNSCSPGDPLVLERPPPRW 367 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/28 (82%), Positives = 23/28 (82%) Frame = -3 Query: 87 RAGSTLHLVPNSCSPGDPLVLERPPPRW 4 RAGS L NSCSPGDPLVLERPPPRW Sbjct: 17 RAGS-LRSRSNSCSPGDPLVLERPPPRW 43 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L+ NSCSPGDPLVLERPPPRW Sbjct: 17 LISNSCSPGDPLVLERPPPRW 37 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 H NSCSPGDPLVLERPPPRW Sbjct: 17 HCASNSCSPGDPLVLERPPPRW 38 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = -3 Query: 108 DHMYP*ARAGSTLHLVPNSCSPGDPLVLERPPPRW 4 D+M R + NSCSPGDPLVLERPPPRW Sbjct: 68 DYMIFIRRGAKRQQMASNSCSPGDPLVLERPPPRW 102 >SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = -3 Query: 78 STLHLVPNSCSPGDPLVLERPPPRW 4 S L L NSCSPGDPLVLERPPPRW Sbjct: 3 SGLFLPSNSCSPGDPLVLERPPPRW 27 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 H + NSCSPGDPLVLERPPPRW Sbjct: 11 HDISNSCSPGDPLVLERPPPRW 32 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/36 (63%), Positives = 25/36 (69%), Gaps = 4/36 (11%) Frame = -3 Query: 99 YP*ARAGSTL----HLVPNSCSPGDPLVLERPPPRW 4 YP + G L +V NSCSPGDPLVLERPPPRW Sbjct: 3459 YPVSAIGKALIYVARVVSNSCSPGDPLVLERPPPRW 3494 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -3 Query: 87 RAGSTLHLVPNSCSPGDPLVLERPPPRW 4 R L V NSCSPGDPLVLERPPPRW Sbjct: 56 RLPGNLRPVSNSCSPGDPLVLERPPPRW 83 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L+ NSCSPGDPLVLERPPPRW Sbjct: 33 LISNSCSPGDPLVLERPPPRW 53 >SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 1/23 (4%) Frame = -3 Query: 69 HLVP-NSCSPGDPLVLERPPPRW 4 HL P NSCSPGDPLVLERPPPRW Sbjct: 52 HLSPSNSCSPGDPLVLERPPPRW 74 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L+ NSCSPGDPLVLERPPPRW Sbjct: 24 LISNSCSPGDPLVLERPPPRW 44 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 L +V NSCSPGDPLVLERPPPRW Sbjct: 17 LTVVSNSCSPGDPLVLERPPPRW 39 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -3 Query: 75 TLHLVPNSCSPGDPLVLERPPPRW 4 T L NSCSPGDPLVLERPPPRW Sbjct: 8 TQELTSNSCSPGDPLVLERPPPRW 31 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L+ NSCSPGDPLVLERPPPRW Sbjct: 70 LISNSCSPGDPLVLERPPPRW 90 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 ++V NSCSPGDPLVLERPPPRW Sbjct: 12 NIVSNSCSPGDPLVLERPPPRW 33 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -3 Query: 78 STLHLVPNSCSPGDPLVLERPPPRW 4 S + + NSCSPGDPLVLERPPPRW Sbjct: 2 SCTYFISNSCSPGDPLVLERPPPRW 26 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 50.0 bits (114), Expect = 2e-06 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 ++L NSCSPGDPLVLERPPPRW Sbjct: 9 VYLASNSCSPGDPLVLERPPPRW 31 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 49.6 bits (113), Expect = 2e-06 Identities = 21/24 (87%), Positives = 22/24 (91%), Gaps = 1/24 (4%) Frame = -3 Query: 72 LHLVP-NSCSPGDPLVLERPPPRW 4 L L+P NSCSPGDPLVLERPPPRW Sbjct: 22 LQLLPSNSCSPGDPLVLERPPPRW 45 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 49.6 bits (113), Expect = 2e-06 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 +H NSCSPGDPLVLERPPPRW Sbjct: 7 MHTRSNSCSPGDPLVLERPPPRW 29 >SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 49.6 bits (113), Expect = 2e-06 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 +H NSCSPGDPLVLERPPPRW Sbjct: 1 MHYGSNSCSPGDPLVLERPPPRW 23 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 49.6 bits (113), Expect = 2e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 +V NSCSPGDPLVLERPPPRW Sbjct: 77 IVSNSCSPGDPLVLERPPPRW 97 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 49.6 bits (113), Expect = 2e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -3 Query: 75 TLHLVPNSCSPGDPLVLERPPPRW 4 +LH V NSCSPGDPLVLERPPPRW Sbjct: 2 SLH-VSNSCSPGDPLVLERPPPRW 24 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 49.6 bits (113), Expect = 2e-06 Identities = 18/22 (81%), Positives = 21/22 (95%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 +++ NSCSPGDPLVLERPPPRW Sbjct: 12 NIISNSCSPGDPLVLERPPPRW 33 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 49.6 bits (113), Expect = 2e-06 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 1/30 (3%) Frame = -3 Query: 90 ARAGSTLHLVP-NSCSPGDPLVLERPPPRW 4 +R G ++P NSCSPGDPLVLERPPPRW Sbjct: 56 SRVGHHTPILPSNSCSPGDPLVLERPPPRW 85 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 49.6 bits (113), Expect = 2e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 +V NSCSPGDPLVLERPPPRW Sbjct: 11 MVSNSCSPGDPLVLERPPPRW 31 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 49.6 bits (113), Expect = 2e-06 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -3 Query: 75 TLHLVPNSCSPGDPLVLERPPPRW 4 T L+ NSCSPGDPLVLERPPPRW Sbjct: 3 TAILLSNSCSPGDPLVLERPPPRW 26 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 49.6 bits (113), Expect = 2e-06 Identities = 20/24 (83%), Positives = 21/24 (87%) Frame = -3 Query: 75 TLHLVPNSCSPGDPLVLERPPPRW 4 T+ V NSCSPGDPLVLERPPPRW Sbjct: 55 TIPPVSNSCSPGDPLVLERPPPRW 78 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 49.6 bits (113), Expect = 2e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 +V NSCSPGDPLVLERPPPRW Sbjct: 1 MVSNSCSPGDPLVLERPPPRW 21 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 49.6 bits (113), Expect = 2e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 +V NSCSPGDPLVLERPPPRW Sbjct: 6 IVSNSCSPGDPLVLERPPPRW 26 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 49.6 bits (113), Expect = 2e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 +V NSCSPGDPLVLERPPPRW Sbjct: 1 MVSNSCSPGDPLVLERPPPRW 21 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 49.6 bits (113), Expect = 2e-06 Identities = 18/22 (81%), Positives = 21/22 (95%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 +++ NSCSPGDPLVLERPPPRW Sbjct: 12 NIISNSCSPGDPLVLERPPPRW 33 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 H NSCSPGDPLVLERPPPRW Sbjct: 16 HNTSNSCSPGDPLVLERPPPRW 37 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 49.2 bits (112), Expect = 3e-06 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 ++ NSCSPGDPLVLERPPPRW Sbjct: 17 IISNSCSPGDPLVLERPPPRW 37 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -3 Query: 78 STLHLVPNSCSPGDPLVLERPPPRW 4 S + + NSCSPGDPLVLERPPPRW Sbjct: 11 SIVQQISNSCSPGDPLVLERPPPRW 35 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L+ NSCSPGDPLVLERPPPRW Sbjct: 62 LLSNSCSPGDPLVLERPPPRW 82 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 L L NSCSPGDPLVLERPPPRW Sbjct: 32 LKLSSNSCSPGDPLVLERPPPRW 54 >SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 L + NSCSPGDPLVLERPPPRW Sbjct: 75 LRFLSNSCSPGDPLVLERPPPRW 97 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 LH V NSCSPGDPLVLERPPPRW Sbjct: 5 LH-VSNSCSPGDPLVLERPPPRW 26 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 49.2 bits (112), Expect = 3e-06 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 ++ NSCSPGDPLVLERPPPRW Sbjct: 14 IISNSCSPGDPLVLERPPPRW 34 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 +V NSCSPGDPLVLERPPPRW Sbjct: 7 VVSNSCSPGDPLVLERPPPRW 27 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L+ NSCSPGDPLVLERPPPRW Sbjct: 54 LLSNSCSPGDPLVLERPPPRW 74 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -3 Query: 75 TLHLVPNSCSPGDPLVLERPPPRW 4 ++ V NSCSPGDPLVLERPPPRW Sbjct: 15 SIAFVSNSCSPGDPLVLERPPPRW 38 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L+ NSCSPGDPLVLERPPPRW Sbjct: 2 LLSNSCSPGDPLVLERPPPRW 22 >SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/52 (46%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = -3 Query: 156 YMDASENPCWLV-LNASDHMYP*ARAGSTLHLVPNSCSPGDPLVLERPPPRW 4 Y S PC + L+ S ++ ++ NSCSPGDPLVLERPPPRW Sbjct: 3 YTIPSYKPCLIPSLHTSQALHHPFIQAKPYNIPSNSCSPGDPLVLERPPPRW 54 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 49.2 bits (112), Expect = 3e-06 Identities = 18/22 (81%), Positives = 21/22 (95%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 +++ NSCSPGDPLVLERPPPRW Sbjct: 4 NVISNSCSPGDPLVLERPPPRW 25 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/23 (91%), Positives = 21/23 (91%), Gaps = 1/23 (4%) Frame = -3 Query: 69 HL-VPNSCSPGDPLVLERPPPRW 4 HL V NSCSPGDPLVLERPPPRW Sbjct: 15 HLKVSNSCSPGDPLVLERPPPRW 37 >SB_29661| Best HMM Match : DUF872 (HMM E-Value=8.6) Length = 345 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = -3 Query: 84 AGSTLHLVPNSCSPGDPLVLERPPPRW 4 A +T + NSCSPGDPLVLERPPPRW Sbjct: 214 ASTTFWGLSNSCSPGDPLVLERPPPRW 240 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 49.2 bits (112), Expect = 3e-06 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 ++ NSCSPGDPLVLERPPPRW Sbjct: 1 MISNSCSPGDPLVLERPPPRW 21 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/29 (65%), Positives = 24/29 (82%) Frame = -3 Query: 90 ARAGSTLHLVPNSCSPGDPLVLERPPPRW 4 A + ++ ++ NSCSPGDPLVLERPPPRW Sbjct: 9 ASSTTSAPVISNSCSPGDPLVLERPPPRW 37 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 2/28 (7%) Frame = -3 Query: 81 GSTLHLVP--NSCSPGDPLVLERPPPRW 4 GS L ++ NSCSPGDPLVLERPPPRW Sbjct: 80 GSALFIIQTSNSCSPGDPLVLERPPPRW 107 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +3 Query: 3 STAVAAALELVDPPGCRNS 59 STAVAAALELVDPPGCRNS Sbjct: 6 STAVAAALELVDPPGCRNS 24 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 49.2 bits (112), Expect = 3e-06 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -3 Query: 81 GSTLHLVPNSCSPGDPLVLERPPPRW 4 GS + NSCSPGDPLVLERPPPRW Sbjct: 66 GSNWYPPSNSCSPGDPLVLERPPPRW 91 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L+ NSCSPGDPLVLERPPPRW Sbjct: 1 LLSNSCSPGDPLVLERPPPRW 21 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 49.2 bits (112), Expect = 3e-06 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 ++ NSCSPGDPLVLERPPPRW Sbjct: 4 IISNSCSPGDPLVLERPPPRW 24 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 ++ V NSCSPGDPLVLERPPPRW Sbjct: 20 VNAVSNSCSPGDPLVLERPPPRW 42 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L+ NSCSPGDPLVLERPPPRW Sbjct: 7 LLSNSCSPGDPLVLERPPPRW 27 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 +V NSCSPGDPLVLERPPPRW Sbjct: 27 VVSNSCSPGDPLVLERPPPRW 47 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 49.2 bits (112), Expect = 3e-06 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 ++ NSCSPGDPLVLERPPPRW Sbjct: 26 IISNSCSPGDPLVLERPPPRW 46 >SB_1940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/27 (70%), Positives = 22/27 (81%) Frame = -3 Query: 84 AGSTLHLVPNSCSPGDPLVLERPPPRW 4 + T+ + NSCSPGDPLVLERPPPRW Sbjct: 62 SAETMVIESNSCSPGDPLVLERPPPRW 88 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 ++ V NSCSPGDPLVLERPPPRW Sbjct: 7 INSVSNSCSPGDPLVLERPPPRW 29 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 30 VSNSCSPGDPLVLERPPPRW 49 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 7 VSNSCSPGDPLVLERPPPRW 26 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/28 (67%), Positives = 20/28 (71%) Frame = -3 Query: 87 RAGSTLHLVPNSCSPGDPLVLERPPPRW 4 R + NSCSPGDPLVLERPPPRW Sbjct: 253 RENPVTEYISNSCSPGDPLVLERPPPRW 280 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 10 VSNSCSPGDPLVLERPPPRW 29 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 15 VSNSCSPGDPLVLERPPPRW 34 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 48.8 bits (111), Expect = 4e-06 Identities = 18/22 (81%), Positives = 21/22 (95%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 +++ NSCSPGDPLVLERPPPRW Sbjct: 12 NILSNSCSPGDPLVLERPPPRW 33 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 2 VSNSCSPGDPLVLERPPPRW 21 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L NSCSPGDPLVLERPPPRW Sbjct: 15 LTSNSCSPGDPLVLERPPPRW 35 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 40 VSNSCSPGDPLVLERPPPRW 59 >SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -3 Query: 84 AGSTLHLVPNSCSPGDPLVLERPPPRW 4 AG L L NSCSPGDPLVLERPPPRW Sbjct: 2 AGRRLFL-SNSCSPGDPLVLERPPPRW 27 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 117 VSNSCSPGDPLVLERPPPRW 136 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 184 VSNSCSPGDPLVLERPPPRW 203 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 48.8 bits (111), Expect = 4e-06 Identities = 20/26 (76%), Positives = 23/26 (88%), Gaps = 2/26 (7%) Frame = -3 Query: 75 TLHLV--PNSCSPGDPLVLERPPPRW 4 T+H++ NSCSPGDPLVLERPPPRW Sbjct: 8 TIHVLNSSNSCSPGDPLVLERPPPRW 33 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 34 VSNSCSPGDPLVLERPPPRW 53 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 H NSCSPGDPLVLERPPPRW Sbjct: 61 HARSNSCSPGDPLVLERPPPRW 82 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 1066 VSNSCSPGDPLVLERPPPRW 1085 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 48.8 bits (111), Expect = 4e-06 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 ++ NSCSPGDPLVLERPPPRW Sbjct: 14 VISNSCSPGDPLVLERPPPRW 34 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L NSCSPGDPLVLERPPPRW Sbjct: 78 LTSNSCSPGDPLVLERPPPRW 98 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 3 VSNSCSPGDPLVLERPPPRW 22 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 214 VSNSCSPGDPLVLERPPPRW 233 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L NSCSPGDPLVLERPPPRW Sbjct: 5 LASNSCSPGDPLVLERPPPRW 25 >SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 + L NSCSPGDPLVLERPPPRW Sbjct: 1 MRLSSNSCSPGDPLVLERPPPRW 23 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 3 VSNSCSPGDPLVLERPPPRW 22 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -3 Query: 87 RAGSTLHLVPNSCSPGDPLVLERPPPRW 4 +A + NSCSPGDPLVLERPPPRW Sbjct: 39 KASKKNFFISNSCSPGDPLVLERPPPRW 66 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 4 VSNSCSPGDPLVLERPPPRW 23 >SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 48.8 bits (111), Expect = 4e-06 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 + + NSCSPGDPLVLERPPPRW Sbjct: 23 MRITSNSCSPGDPLVLERPPPRW 45 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L NSCSPGDPLVLERPPPRW Sbjct: 6 LASNSCSPGDPLVLERPPPRW 26 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 H NSCSPGDPLVLERPPPRW Sbjct: 90 HARSNSCSPGDPLVLERPPPRW 111 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 4 VSNSCSPGDPLVLERPPPRW 23 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 11 VSNSCSPGDPLVLERPPPRW 30 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 25 VSNSCSPGDPLVLERPPPRW 44 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 15 VSNSCSPGDPLVLERPPPRW 34 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L NSCSPGDPLVLERPPPRW Sbjct: 17 LASNSCSPGDPLVLERPPPRW 37 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 10 VSNSCSPGDPLVLERPPPRW 29 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 31 VSNSCSPGDPLVLERPPPRW 50 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 4 VSNSCSPGDPLVLERPPPRW 23 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 41 VSNSCSPGDPLVLERPPPRW 60 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 15 VSNSCSPGDPLVLERPPPRW 34 >SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 48.8 bits (111), Expect = 4e-06 Identities = 21/25 (84%), Positives = 22/25 (88%), Gaps = 1/25 (4%) Frame = -3 Query: 75 TLHLVP-NSCSPGDPLVLERPPPRW 4 +L VP NSCSPGDPLVLERPPPRW Sbjct: 8 SLGFVPSNSCSPGDPLVLERPPPRW 32 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 4 VSNSCSPGDPLVLERPPPRW 23 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 14 VSNSCSPGDPLVLERPPPRW 33 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 6 VSNSCSPGDPLVLERPPPRW 25 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 15 VSNSCSPGDPLVLERPPPRW 34 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L NSCSPGDPLVLERPPPRW Sbjct: 37 LTSNSCSPGDPLVLERPPPRW 57 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L NSCSPGDPLVLERPPPRW Sbjct: 20 LASNSCSPGDPLVLERPPPRW 40 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 30 VSNSCSPGDPLVLERPPPRW 49 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 32 VSNSCSPGDPLVLERPPPRW 51 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 10 VSNSCSPGDPLVLERPPPRW 29 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 17 VSNSCSPGDPLVLERPPPRW 36 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 14 VSNSCSPGDPLVLERPPPRW 33 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 34 VSNSCSPGDPLVLERPPPRW 53 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L NSCSPGDPLVLERPPPRW Sbjct: 11 LASNSCSPGDPLVLERPPPRW 31 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 8 VSNSCSPGDPLVLERPPPRW 27 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 10 VSNSCSPGDPLVLERPPPRW 29 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 18 VSNSCSPGDPLVLERPPPRW 37 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L NSCSPGDPLVLERPPPRW Sbjct: 3 LASNSCSPGDPLVLERPPPRW 23 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L NSCSPGDPLVLERPPPRW Sbjct: 15 LTSNSCSPGDPLVLERPPPRW 35 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 27 VSNSCSPGDPLVLERPPPRW 46 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L NSCSPGDPLVLERPPPRW Sbjct: 7 LASNSCSPGDPLVLERPPPRW 27 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 193 VSNSCSPGDPLVLERPPPRW 212 >SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 48.8 bits (111), Expect = 4e-06 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 +++ NSCSPGDPLVLERPPPRW Sbjct: 48 VYVTSNSCSPGDPLVLERPPPRW 70 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 9 VSNSCSPGDPLVLERPPPRW 28 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 V NSCSPGDPLVLERPPPRW Sbjct: 17 VSNSCSPGDPLVLERPPPRW 36 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 48.8 bits (111), Expect = 4e-06 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 ++ NSCSPGDPLVLERPPPRW Sbjct: 25 VISNSCSPGDPLVLERPPPRW 45 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L NSCSPGDPLVLERPPPRW Sbjct: 11 LTSNSCSPGDPLVLERPPPRW 31 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L NSCSPGDPLVLERPPPRW Sbjct: 96 LASNSCSPGDPLVLERPPPRW 116 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L NSCSPGDPLVLERPPPRW Sbjct: 4 LASNSCSPGDPLVLERPPPRW 24 >SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.8 bits (111), Expect = 4e-06 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 + + NSCSPGDPLVLERPPPRW Sbjct: 7 IRYISNSCSPGDPLVLERPPPRW 29 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 48.4 bits (110), Expect = 6e-06 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -3 Query: 84 AGSTLHLVPNSCSPGDPLVLERPPPRW 4 A + + NSCSPGDPLVLERPPPRW Sbjct: 27 AKQRMEYLSNSCSPGDPLVLERPPPRW 53 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 ++ NSCSPGDPLVLERPPPRW Sbjct: 12 NIASNSCSPGDPLVLERPPPRW 33 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 5 ISNSCSPGDPLVLERPPPRW 24 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 101 ISNSCSPGDPLVLERPPPRW 120 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 48.4 bits (110), Expect = 6e-06 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = -3 Query: 105 HMYP*ARAGSTLHLVPNSCSPGDPLVLERPPPRW 4 H+ P A + NSCSPGDPLVLERPPPRW Sbjct: 40 HLEP-AFLAEGFRVASNSCSPGDPLVLERPPPRW 72 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 ++ NSCSPGDPLVLERPPPRW Sbjct: 36 NIASNSCSPGDPLVLERPPPRW 57 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 48.4 bits (110), Expect = 6e-06 Identities = 20/24 (83%), Positives = 20/24 (83%), Gaps = 2/24 (8%) Frame = -3 Query: 69 HLVP--NSCSPGDPLVLERPPPRW 4 H P NSCSPGDPLVLERPPPRW Sbjct: 137 HFAPSSNSCSPGDPLVLERPPPRW 160 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 21 ISNSCSPGDPLVLERPPPRW 40 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 48.4 bits (110), Expect = 6e-06 Identities = 19/25 (76%), Positives = 20/25 (80%) Frame = -3 Query: 78 STLHLVPNSCSPGDPLVLERPPPRW 4 S + NSCSPGDPLVLERPPPRW Sbjct: 18 SQTRVTSNSCSPGDPLVLERPPPRW 42 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 48.4 bits (110), Expect = 6e-06 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 L + NSCSPGDPLVLERPPPRW Sbjct: 18 LLITSNSCSPGDPLVLERPPPRW 40 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 59 ISNSCSPGDPLVLERPPPRW 78 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 9 ISNSCSPGDPLVLERPPPRW 28 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 10 ISNSCSPGDPLVLERPPPRW 29 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 3 ISNSCSPGDPLVLERPPPRW 22 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 ++ NSCSPGDPLVLERPPPRW Sbjct: 55 ILSNSCSPGDPLVLERPPPRW 75 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 4 ISNSCSPGDPLVLERPPPRW 23 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 52 ISNSCSPGDPLVLERPPPRW 71 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 51 ISNSCSPGDPLVLERPPPRW 70 >SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 48.4 bits (110), Expect = 6e-06 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 H NSCSPGDPLVLERPPPRW Sbjct: 27 HNQSNSCSPGDPLVLERPPPRW 48 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 16 ISNSCSPGDPLVLERPPPRW 35 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 + + NSCSPGDPLVLERPPPRW Sbjct: 16 IKITSNSCSPGDPLVLERPPPRW 38 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.4 bits (110), Expect = 6e-06 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -3 Query: 75 TLHLVPNSCSPGDPLVLERPPPRW 4 T+ NSCSPGDPLVLERPPPRW Sbjct: 6 TMPRASNSCSPGDPLVLERPPPRW 29 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 21 ISNSCSPGDPLVLERPPPRW 40 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 4 ISNSCSPGDPLVLERPPPRW 23 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 7 ISNSCSPGDPLVLERPPPRW 26 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 4 ISNSCSPGDPLVLERPPPRW 23 >SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 48.4 bits (110), Expect = 6e-06 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 H NSCSPGDPLVLERPPPRW Sbjct: 19 HKGSNSCSPGDPLVLERPPPRW 40 >SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 48.4 bits (110), Expect = 6e-06 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 H NSCSPGDPLVLERPPPRW Sbjct: 12 HEPSNSCSPGDPLVLERPPPRW 33 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 32 ISNSCSPGDPLVLERPPPRW 51 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 ++ NSCSPGDPLVLERPPPRW Sbjct: 12 NITSNSCSPGDPLVLERPPPRW 33 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 18 ISNSCSPGDPLVLERPPPRW 37 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 32 ISNSCSPGDPLVLERPPPRW 51 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 974 ISNSCSPGDPLVLERPPPRW 993 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 6 ISNSCSPGDPLVLERPPPRW 25 >SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 48.4 bits (110), Expect = 6e-06 Identities = 21/28 (75%), Positives = 23/28 (82%), Gaps = 3/28 (10%) Frame = -3 Query: 78 STLHLV---PNSCSPGDPLVLERPPPRW 4 S+LH + NSCSPGDPLVLERPPPRW Sbjct: 16 SSLHKINNLSNSCSPGDPLVLERPPPRW 43 >SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 1 ISNSCSPGDPLVLERPPPRW 20 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 5 ISNSCSPGDPLVLERPPPRW 24 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 48.4 bits (110), Expect = 6e-06 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 L NSCSPGDPLVLERPPPRW Sbjct: 23 LQAASNSCSPGDPLVLERPPPRW 45 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 32 ISNSCSPGDPLVLERPPPRW 51 >SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 + + NSCSPGDPLVLERPPPRW Sbjct: 1 MKITSNSCSPGDPLVLERPPPRW 23 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 48.4 bits (110), Expect = 6e-06 Identities = 20/25 (80%), Positives = 21/25 (84%), Gaps = 3/25 (12%) Frame = -3 Query: 69 HLVP---NSCSPGDPLVLERPPPRW 4 H +P NSCSPGDPLVLERPPPRW Sbjct: 32 HAIPALSNSCSPGDPLVLERPPPRW 56 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 116 ISNSCSPGDPLVLERPPPRW 135 >SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 2 ISNSCSPGDPLVLERPPPRW 21 >SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 2 ISNSCSPGDPLVLERPPPRW 21 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 14 ISNSCSPGDPLVLERPPPRW 33 >SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 2 ISNSCSPGDPLVLERPPPRW 21 >SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 8 ISNSCSPGDPLVLERPPPRW 27 >SB_20200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 ++ NSCSPGDPLVLERPPPRW Sbjct: 1 VYFTSNSCSPGDPLVLERPPPRW 23 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 90 ISNSCSPGDPLVLERPPPRW 109 >SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 48.4 bits (110), Expect = 6e-06 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -3 Query: 81 GSTLHLVPNSCSPGDPLVLERPPPRW 4 G+T NSCSPGDPLVLERPPPRW Sbjct: 6 GTTERPGSNSCSPGDPLVLERPPPRW 31 >SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -3 Query: 72 LHLVPNSCSPGDPLVLERPPPRW 4 + + NSCSPGDPLVLERPPPRW Sbjct: 18 IDIASNSCSPGDPLVLERPPPRW 40 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 ++ NSCSPGDPLVLERPPPRW Sbjct: 12 ILSNSCSPGDPLVLERPPPRW 32 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 6 ISNSCSPGDPLVLERPPPRW 25 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 68 ISNSCSPGDPLVLERPPPRW 87 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 30 ISNSCSPGDPLVLERPPPRW 49 >SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 46 ISNSCSPGDPLVLERPPPRW 65 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 45 ISNSCSPGDPLVLERPPPRW 64 >SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 591 ISNSCSPGDPLVLERPPPRW 610 >SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 4 ISNSCSPGDPLVLERPPPRW 23 >SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 12 ISNSCSPGDPLVLERPPPRW 31 >SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.4 bits (110), Expect = 6e-06 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 63 VPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 10 ISNSCSPGDPLVLERPPPRW 29 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 48.0 bits (109), Expect = 8e-06 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -3 Query: 69 HLVPNSCSPGDPLVLERPPPRW 4 +L NSCSPGDPLVLERPPPRW Sbjct: 19 NLRSNSCSPGDPLVLERPPPRW 40 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 48.0 bits (109), Expect = 8e-06 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 + NSCSPGDPLVLERPPPRW Sbjct: 1 MASNSCSPGDPLVLERPPPRW 21 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 48.0 bits (109), Expect = 8e-06 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -3 Query: 78 STLHLVPNSCSPGDPLVLERPPPRW 4 S + + NSCSPGDPLVLERPPPRW Sbjct: 42 SRVVVTSNSCSPGDPLVLERPPPRW 66 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 48.0 bits (109), Expect = 8e-06 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 ++ NSCSPGDPLVLERPPPRW Sbjct: 92 VLSNSCSPGDPLVLERPPPRW 112 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 48.0 bits (109), Expect = 8e-06 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -3 Query: 75 TLHLVPNSCSPGDPLVLERPPPRW 4 T + NSCSPGDPLVLERPPPRW Sbjct: 58 TAKKLSNSCSPGDPLVLERPPPRW 81 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 48.0 bits (109), Expect = 8e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L NSCSPGDPLVLERPPPRW Sbjct: 23 LSSNSCSPGDPLVLERPPPRW 43 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 48.0 bits (109), Expect = 8e-06 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 ++ NSCSPGDPLVLERPPPRW Sbjct: 12 VLSNSCSPGDPLVLERPPPRW 32 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 48.0 bits (109), Expect = 8e-06 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 ++ NSCSPGDPLVLERPPPRW Sbjct: 15 VLSNSCSPGDPLVLERPPPRW 35 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 48.0 bits (109), Expect = 8e-06 Identities = 20/28 (71%), Positives = 20/28 (71%) Frame = -3 Query: 87 RAGSTLHLVPNSCSPGDPLVLERPPPRW 4 R S NSCSPGDPLVLERPPPRW Sbjct: 21 RVASLCRSRSNSCSPGDPLVLERPPPRW 48 >SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 48.0 bits (109), Expect = 8e-06 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = -3 Query: 78 STLHLVPNSCSPGDPLVLERPPPRW 4 S NSCSPGDPLVLERPPPRW Sbjct: 3 SRFQATSNSCSPGDPLVLERPPPRW 27 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 48.0 bits (109), Expect = 8e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 66 LVPNSCSPGDPLVLERPPPRW 4 L NSCSPGDPLVLERPPPRW Sbjct: 4 LSSNSCSPGDPLVLERPPPRW 24 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,904,001 Number of Sequences: 59808 Number of extensions: 483224 Number of successful extensions: 4868 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4646 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -