BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30373 (603 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9HW85 Cluster: Exodeoxyribonuclease I; n=19; Pseudomon... 34 3.0 UniRef50_UPI00015615D9 Cluster: PREDICTED: hypothetical protein;... 33 5.2 >UniRef50_Q9HW85 Cluster: Exodeoxyribonuclease I; n=19; Pseudomonas|Rep: Exodeoxyribonuclease I - Pseudomonas aeruginosa Length = 480 Score = 33.9 bits (74), Expect = 3.0 Identities = 15/38 (39%), Positives = 25/38 (65%) Frame = -2 Query: 305 STLACFKGIVQSHPALYDYICRLRTQFHRLSQIKALKP 192 +T+A + I Q P LYDY+ +LR++ L Q++ L+P Sbjct: 184 ATIALARLIRQRQPRLYDYLYQLRSKHKVLDQVRLLQP 221 >UniRef50_UPI00015615D9 Cluster: PREDICTED: hypothetical protein; n=1; Equus caballus|Rep: PREDICTED: hypothetical protein - Equus caballus Length = 550 Score = 33.1 bits (72), Expect = 5.2 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -2 Query: 329 CHYCRKTLSTLACFKGIVQSHPALYDYICR 240 C +C KTLS+L+C +G ++ H Y C+ Sbjct: 443 CQHCGKTLSSLSCLRGHLRMHTGERPYECQ 472 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 547,086,151 Number of Sequences: 1657284 Number of extensions: 9997613 Number of successful extensions: 18696 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18696 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 42732687689 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -