BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30373 (603 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0531 - 6934736-6935068,6935079-6935135 28 6.5 03_02_0448 + 8593574-8594203,8595027-8595246,8595950-8595999 27 8.7 >04_01_0531 - 6934736-6935068,6935079-6935135 Length = 129 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -2 Query: 197 KPYTINRSLMLLVYCKSTRSRPTKLAVRMYATPLSLH 87 KP TI+ ++++ + CKS RSR L AT +S H Sbjct: 4 KPLTIDENVVMRISCKSRRSRHDALV----ATTISQH 36 >03_02_0448 + 8593574-8594203,8595027-8595246,8595950-8595999 Length = 299 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +1 Query: 139 DRVDLQYTSNINDRLIVYGFSA 204 DRVDL+ T ++ +++V GFS+ Sbjct: 185 DRVDLRITGDVGAKILVLGFSS 206 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,907,559 Number of Sequences: 37544 Number of extensions: 251935 Number of successful extensions: 446 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1431112012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -