BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30373 (603 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC022022-1|AAH22022.2| 628|Homo sapiens zinc finger protein 555... 31 3.1 AK056659-1|BAB71244.1| 440|Homo sapiens protein ( Homo sapiens ... 31 3.1 >BC022022-1|AAH22022.2| 628|Homo sapiens zinc finger protein 555 protein. Length = 628 Score = 31.1 bits (67), Expect = 3.1 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -2 Query: 329 CHYCRKTLSTLACFKGIVQSHPALYDYICRL 237 C C K S ACF+ V+ HP Y C+L Sbjct: 454 CKQCGKAFSLSACFREHVRMHPEDKSYECKL 484 >AK056659-1|BAB71244.1| 440|Homo sapiens protein ( Homo sapiens cDNA FLJ32097 fis, clone OCBBF2001101, moderately similar to ZINC FINGER PROTEIN 91. ). Length = 440 Score = 31.1 bits (67), Expect = 3.1 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -2 Query: 329 CHYCRKTLSTLACFKGIVQSHPALYDYICRL 237 C C K S ACF+ V+ HP Y C+L Sbjct: 266 CKQCGKAFSLSACFREHVRMHPEDKSYECKL 296 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,750,623 Number of Sequences: 237096 Number of extensions: 1540006 Number of successful extensions: 13418 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13254 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13418 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6354183230 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -