BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30373 (603 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 22 4.0 AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 21 7.0 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 21 7.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 7.0 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 22.2 bits (45), Expect = 4.0 Identities = 8/30 (26%), Positives = 14/30 (46%) Frame = -2 Query: 329 CHYCRKTLSTLACFKGIVQSHPALYDYICR 240 CH C K S +G +++H + C+ Sbjct: 45 CHLCGKAFSRPWLLQGHIRTHTGEKPFSCQ 74 Score = 21.4 bits (43), Expect = 7.0 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -2 Query: 329 CHYCRKTLSTLACFKGIVQSH 267 C YC K +L K +++H Sbjct: 19 CKYCEKVYVSLGALKMHIRTH 39 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 21.4 bits (43), Expect = 7.0 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 395 YKSTLHTW 372 YKSTLH W Sbjct: 253 YKSTLHCW 260 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 21.4 bits (43), Expect = 7.0 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 395 YKSTLHTW 372 YKSTLH W Sbjct: 253 YKSTLHCW 260 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 7.0 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = -2 Query: 323 YCRKTLSTLACFKGIVQSHPALYDYICRLRTQFHRLSQ 210 Y +K ++ A FKG+ + + + RL ++ RLS+ Sbjct: 763 YIQKMIAAAAPFKGMETQDYRIPEVMRRLMSEDKRLSK 800 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,385 Number of Sequences: 438 Number of extensions: 3189 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17726685 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -