BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30367 (700 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 26 1.3 AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 25 2.3 AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 25 3.0 AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembran... 25 3.0 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 25 3.0 AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 23 7.0 AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltr... 23 9.2 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 25.8 bits (54), Expect = 1.3 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +1 Query: 94 SESSTQINHNKEEQSTTKIPDSVKKIILMEKDNEANANRKSRIDLNALPTRQY 252 S S + + ++EE KI + ++ K+ E NR R DLNA +QY Sbjct: 382 SSSDSSSSSSEEEAENFKI-STAEQYKKQAKEVERRGNRNRR-DLNAFKEKQY 432 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 25.0 bits (52), Expect = 2.3 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +1 Query: 94 SESSTQINHNKEEQSTTKIPDSVKKIILMEKDNEANANRKSRIDLNALPTRQY 252 S S + + ++EE KI + ++ K+ E NR R DLNA +QY Sbjct: 382 SSSDSSSSSSEEEAENFKISPA-EQYKKQAKEVERRGNRNRR-DLNAFKEKQY 432 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 24.6 bits (51), Expect = 3.0 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 187 LFPLI*FSLPNLVFSSWIVLPCCDLSVL 104 LF ++ +L +++F SW++L C L L Sbjct: 205 LFSMVQSNLADVMFCSWLLLACEQLQHL 232 >AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 331 Score = 24.6 bits (51), Expect = 3.0 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 187 LFPLI*FSLPNLVFSSWIVLPCCDLSVL 104 LF ++ +L +++F SW++L C L L Sbjct: 58 LFSMVQSNLADVMFCSWLLLACEQLQHL 85 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 24.6 bits (51), Expect = 3.0 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 187 LFPLI*FSLPNLVFSSWIVLPCCDLSVL 104 LF ++ +L +++F SW++L C L L Sbjct: 205 LFSMVQSNLADVMFCSWLLLACEQLQHL 232 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 23.4 bits (48), Expect = 7.0 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -3 Query: 461 LATFIVCIIIKLYLCLWVCWLIIVI 387 LAT ++C++I LC +I ++ Sbjct: 309 LATMLICVVIVFLLCNLPAMMINIV 333 >AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltransferase protein. Length = 426 Score = 23.0 bits (47), Expect = 9.2 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 112 INHNKEEQSTTKIPDSVKKIILMEKDNEA 198 + HN E+S + S +K L KD++A Sbjct: 58 VKHNSTEKSQKSVSSSDEKPTLWLKDHDA 86 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 709,342 Number of Sequences: 2352 Number of extensions: 14178 Number of successful extensions: 72 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -