BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30364 (811 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 27 0.13 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 25 0.71 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 23 2.9 AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 21 8.8 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 27.5 bits (58), Expect = 0.13 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 449 TTGTRTWWSNLTTSP 493 TT TWWS+ TTSP Sbjct: 1036 TTKPSTWWSSTTTSP 1050 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 25.0 bits (52), Expect = 0.71 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = -2 Query: 153 SFGLHSMHLVPSAFCTMQSIPIELKSETGRPTLVFRSTPSCVN 25 SFGLH+ PS +P ++ S + R+T C N Sbjct: 253 SFGLHATGSAPSPTAGAGGLPPQVPSPRSQRRYTGRATCDCPN 295 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 23.0 bits (47), Expect = 2.9 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -1 Query: 223 LSATNGINNGPFLILSVGIDGDQVVRSPFYAFSSVGV 113 +SA+ I + FL + VGI D + R A VG+ Sbjct: 57 ISASTRIKSFKFLTIGVGITTDTIDRVFTVAIPFVGI 93 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 21.4 bits (43), Expect = 8.8 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 147 RTT*SPSIPTLKIKNGPLLIPLVADN 224 R T SP+ + KIKN LI A+N Sbjct: 88 RATLSPAFTSSKIKNMYSLISECAEN 113 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,268 Number of Sequences: 336 Number of extensions: 4342 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22102797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -