BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30364 (811 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_1007 - 22210263-22210400,22210506-22210547,22210626-222107... 30 1.9 11_04_0375 + 16933688-16933703,16936291-16937063 28 7.6 >10_08_1007 - 22210263-22210400,22210506-22210547,22210626-22210727, 22212239-22212337,22212413-22212473,22213311-22213432, 22217700-22217786,22217958-22218041,22218141-22218220, 22218404-22218467,22218904-22218972,22219099-22219179, 22219626-22219694,22220108-22220140 Length = 376 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +1 Query: 478 PNDESQVLNKCLPN*IYLRRIRLMSCGIWFLISNRGLTK 594 P D Q +Y ++I L++C IW L+ G+T+ Sbjct: 6 PTDSDQFTGNSEIRLVYCKQIMLITCYIWVLVEANGVTR 44 >11_04_0375 + 16933688-16933703,16936291-16937063 Length = 262 Score = 28.3 bits (60), Expect = 7.6 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 86 SIGMLCIVQNADGTKCIEWRPNDLITI 166 ++G L +Q DG+ IEWR N LI + Sbjct: 6 ALGQLKAIQLLDGSNYIEWRNNVLINL 32 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,245,113 Number of Sequences: 37544 Number of extensions: 499533 Number of successful extensions: 1261 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1233 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1261 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2209429392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -