BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30364 (811 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC003516-1|AAH03516.1| 648|Homo sapiens TBC1 domain family, mem... 32 2.8 AK022230-1|BAB13991.1| 648|Homo sapiens protein ( Homo sapiens ... 32 2.8 >BC003516-1|AAH03516.1| 648|Homo sapiens TBC1 domain family, member 17 protein. Length = 648 Score = 31.9 bits (69), Expect = 2.8 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = +3 Query: 510 FAELDIFTENTTDVVWNLVSNFKQRPYETTLEAFSKLTD 626 F L +F ++++ N+VS F Q PY TT +FS++T+ Sbjct: 198 FHHLQLFDQDSS----NVVSRFLQDPYSTTFSSFSRVTN 232 >AK022230-1|BAB13991.1| 648|Homo sapiens protein ( Homo sapiens cDNA FLJ12168 fis, clone MAMMA1000625, weakly similar to GYP7 PROTEIN. ). Length = 648 Score = 31.9 bits (69), Expect = 2.8 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = +3 Query: 510 FAELDIFTENTTDVVWNLVSNFKQRPYETTLEAFSKLTD 626 F L +F ++++ N+VS F Q PY TT +FS++T+ Sbjct: 198 FHHLQLFDQDSS----NVVSRFLQDPYSTTFSSFSRVTN 232 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,293,182 Number of Sequences: 237096 Number of extensions: 2739518 Number of successful extensions: 6821 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6008 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6820 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10036353240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -