BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30360 (824 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 46 1e-06 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 46 1e-06 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 46 1e-06 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 46 1e-06 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 46 1e-06 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 46 1e-06 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 46 1e-06 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 46 1e-06 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 46 1e-06 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 46 1e-06 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 46 1e-06 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 46 1e-06 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 46 1e-06 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 43 1e-05 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 26 1.6 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 25 3.7 AJ000502-1|CAA04136.1| 299|Anopheles gambiae iron regulatory pr... 24 4.9 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 46.0 bits (104), Expect = 1e-06 Identities = 23/51 (45%), Positives = 26/51 (50%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D HTGD K QHE R GD V G+ R V Y AD +GF Sbjct: 94 FSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 Score = 24.2 bits (50), Expect = 4.9 Identities = 16/59 (27%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = -2 Query: 454 HHGGRFVEYGVPVHDELGRGVLEQRSQLHGL*VRDGVPVQSSEA-VRVVAHGEFAHDGY 281 HH E+ VHDE + Q HG V + S+ R+V + H G+ Sbjct: 86 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 46.0 bits (104), Expect = 1e-06 Identities = 23/51 (45%), Positives = 26/51 (50%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D HTGD K QHE R GD V G+ R V Y AD +GF Sbjct: 86 FSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 Score = 24.2 bits (50), Expect = 4.9 Identities = 16/59 (27%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = -2 Query: 454 HHGGRFVEYGVPVHDELGRGVLEQRSQLHGL*VRDGVPVQSSEA-VRVVAHGEFAHDGY 281 HH E+ VHDE + Q HG V + S+ R+V + H G+ Sbjct: 78 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 46.0 bits (104), Expect = 1e-06 Identities = 23/51 (45%), Positives = 26/51 (50%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D HTGD K QHE R GD V G+ R V Y AD +GF Sbjct: 86 FSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 Score = 24.2 bits (50), Expect = 4.9 Identities = 16/59 (27%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = -2 Query: 454 HHGGRFVEYGVPVHDELGRGVLEQRSQLHGL*VRDGVPVQSSEA-VRVVAHGEFAHDGY 281 HH E+ VHDE + Q HG V + S+ R+V + H G+ Sbjct: 78 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 46.0 bits (104), Expect = 1e-06 Identities = 23/51 (45%), Positives = 26/51 (50%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D HTGD K QHE R GD V G+ R V Y AD +GF Sbjct: 86 FSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 Score = 24.2 bits (50), Expect = 4.9 Identities = 16/59 (27%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = -2 Query: 454 HHGGRFVEYGVPVHDELGRGVLEQRSQLHGL*VRDGVPVQSSEA-VRVVAHGEFAHDGY 281 HH E+ VHDE + Q HG V + S+ R+V + H G+ Sbjct: 78 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 46.0 bits (104), Expect = 1e-06 Identities = 23/51 (45%), Positives = 26/51 (50%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D HTGD K QHE R GD V G+ R V Y AD +GF Sbjct: 94 FSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTGF 144 Score = 23.8 bits (49), Expect = 6.5 Identities = 16/59 (27%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = -2 Query: 454 HHGGRFVEYGVPVHDELGRGVLEQRSQLHGL*VRDGVPVQSSEA-VRVVAHGEFAHDGY 281 HH E+ VHDE + Q HG V + S+ R+V + H G+ Sbjct: 86 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTGF 144 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 46.0 bits (104), Expect = 1e-06 Identities = 23/51 (45%), Positives = 26/51 (50%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D HTGD K QHE R GD V G+ R V Y AD +GF Sbjct: 86 FSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 Score = 24.2 bits (50), Expect = 4.9 Identities = 16/59 (27%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = -2 Query: 454 HHGGRFVEYGVPVHDELGRGVLEQRSQLHGL*VRDGVPVQSSEA-VRVVAHGEFAHDGY 281 HH E+ VHDE + Q HG V + S+ R+V + H G+ Sbjct: 78 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 46.0 bits (104), Expect = 1e-06 Identities = 23/51 (45%), Positives = 26/51 (50%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D HTGD K QHE R GD V G+ R V Y AD +GF Sbjct: 94 FSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 Score = 24.2 bits (50), Expect = 4.9 Identities = 16/59 (27%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = -2 Query: 454 HHGGRFVEYGVPVHDELGRGVLEQRSQLHGL*VRDGVPVQSSEA-VRVVAHGEFAHDGY 281 HH E+ VHDE + Q HG V + S+ R+V + H G+ Sbjct: 86 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 46.0 bits (104), Expect = 1e-06 Identities = 23/51 (45%), Positives = 26/51 (50%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D HTGD K QHE R GD V G+ R V Y AD +GF Sbjct: 118 FSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 168 Score = 24.2 bits (50), Expect = 4.9 Identities = 16/59 (27%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = -2 Query: 454 HHGGRFVEYGVPVHDELGRGVLEQRSQLHGL*VRDGVPVQSSEA-VRVVAHGEFAHDGY 281 HH E+ VHDE + Q HG V + S+ R+V + H G+ Sbjct: 110 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 168 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 46.0 bits (104), Expect = 1e-06 Identities = 23/51 (45%), Positives = 26/51 (50%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D HTGD K QHE R GD V G+ R V Y AD +GF Sbjct: 86 FSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 Score = 24.2 bits (50), Expect = 4.9 Identities = 16/59 (27%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = -2 Query: 454 HHGGRFVEYGVPVHDELGRGVLEQRSQLHGL*VRDGVPVQSSEA-VRVVAHGEFAHDGY 281 HH E+ VHDE + Q HG V + S+ R+V + H G+ Sbjct: 78 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 46.0 bits (104), Expect = 1e-06 Identities = 23/51 (45%), Positives = 26/51 (50%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D HTGD K QHE R GD V G+ R V Y AD +GF Sbjct: 94 FSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 Score = 24.2 bits (50), Expect = 4.9 Identities = 16/59 (27%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = -2 Query: 454 HHGGRFVEYGVPVHDELGRGVLEQRSQLHGL*VRDGVPVQSSEA-VRVVAHGEFAHDGY 281 HH E+ VHDE + Q HG V + S+ R+V + H G+ Sbjct: 86 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 46.0 bits (104), Expect = 1e-06 Identities = 23/51 (45%), Positives = 26/51 (50%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D HTGD K QHE R GD V G+ R V Y AD +GF Sbjct: 86 FSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 Score = 24.2 bits (50), Expect = 4.9 Identities = 16/59 (27%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = -2 Query: 454 HHGGRFVEYGVPVHDELGRGVLEQRSQLHGL*VRDGVPVQSSEA-VRVVAHGEFAHDGY 281 HH E+ VHDE + Q HG V + S+ R+V + H G+ Sbjct: 78 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 46.0 bits (104), Expect = 1e-06 Identities = 23/51 (45%), Positives = 26/51 (50%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D HTGD K QHE R GD V G+ R V Y AD +GF Sbjct: 94 FSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 Score = 24.2 bits (50), Expect = 4.9 Identities = 16/59 (27%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = -2 Query: 454 HHGGRFVEYGVPVHDELGRGVLEQRSQLHGL*VRDGVPVQSSEA-VRVVAHGEFAHDGY 281 HH E+ VHDE + Q HG V + S+ R+V + H G+ Sbjct: 86 HHAPANYEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 144 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 46.0 bits (104), Expect = 1e-06 Identities = 23/51 (45%), Positives = 26/51 (50%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D HTGD K QHE R GD V G+ R V Y AD +GF Sbjct: 86 FSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 Score = 24.2 bits (50), Expect = 4.9 Identities = 16/59 (27%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = -2 Query: 454 HHGGRFVEYGVPVHDELGRGVLEQRSQLHGL*VRDGVPVQSSEA-VRVVAHGEFAHDGY 281 HH E+ VHDE + Q HG V + S+ R+V + H G+ Sbjct: 78 HHAPANYEFSYSVHDEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGF 136 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 42.7 bits (96), Expect = 1e-05 Identities = 22/42 (52%), Positives = 26/42 (61%) Frame = +3 Query: 537 TGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 TGD+K Q E RDGDVV+G + RTV YTAD +GF Sbjct: 34 TGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNGF 75 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 25.8 bits (54), Expect = 1.6 Identities = 21/80 (26%), Positives = 30/80 (37%) Frame = +3 Query: 201 PTPHPLTRTTQGIPTGTLVFPKYRPSRYPS*ANSP*ATTRTASLLCTGTPSRTYSP*SCD 380 P P T T PT T P + S P TT T + + T++P + Sbjct: 178 PPPTTTTTTVWTDPTATTTTPASTTTTTWSDLPPPPPTTTTTVWIDPTATTTTHAPTTTT 237 Query: 381 RCSNTPRPSSSCTGTPYSTN 440 S+ P P + T T T+ Sbjct: 238 TWSDLPPPPPTTTTTTVWTD 257 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.6 bits (51), Expect = 3.7 Identities = 21/80 (26%), Positives = 29/80 (36%) Frame = +3 Query: 201 PTPHPLTRTTQGIPTGTLVFPKYRPSRYPS*ANSP*ATTRTASLLCTGTPSRTYSP*SCD 380 P P T T PT T P + S P TT T + + T+ P + Sbjct: 178 PPPTTTTTTVWTDPTATTTTPASTTTTTWSDLPPPPPTTTTTVWIDPTATTTTHVPTTTT 237 Query: 381 RCSNTPRPSSSCTGTPYSTN 440 S+ P P + T T T+ Sbjct: 238 TWSDLPPPPPTTTTTTVWTD 257 >AJ000502-1|CAA04136.1| 299|Anopheles gambiae iron regulatory protein protein. Length = 299 Score = 24.2 bits (50), Expect = 4.9 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 89 GYTLQTLVKHDVPQKIKTHHAIPVKT 166 G T Q L +P+ K H IPV T Sbjct: 238 GLTGQELFSIAIPESCKPHERIPVST 263 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 807,658 Number of Sequences: 2352 Number of extensions: 15719 Number of successful extensions: 52 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 87734433 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -