BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30360 (824 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-3165|AAF49150.3| 1242|Drosophila melanogaster CG9299-PA... 69 8e-12 BT024400-1|ABC86462.1| 162|Drosophila melanogaster IP05056p pro... 63 5e-10 AE014296-1423|AAF50442.1| 162|Drosophila melanogaster CG7076-PA... 63 5e-10 AY061158-1|AAL28706.1| 180|Drosophila melanogaster LD12613p pro... 62 7e-10 AE014296-371|AAF47580.1| 180|Drosophila melanogaster CG1919-PA ... 62 7e-10 BT016066-1|AAV36951.1| 138|Drosophila melanogaster LP12967p pro... 62 1e-09 AE014296-1422|AAF50443.2| 407|Drosophila melanogaster CG7072-PA... 62 1e-09 BT022916-1|AAY55332.1| 136|Drosophila melanogaster IP04416p pro... 58 1e-08 AE014296-793|AAF47862.1| 147|Drosophila melanogaster CG15007-PA... 58 1e-08 BT010217-1|AAQ23535.1| 194|Drosophila melanogaster RH05746p pro... 57 3e-08 AE014296-370|AAF47579.2| 194|Drosophila melanogaster CG13935-PA... 57 3e-08 BT022412-1|AAY54828.1| 424|Drosophila melanogaster IP11572p pro... 56 4e-08 BT022352-1|AAY54768.1| 424|Drosophila melanogaster IP11272p pro... 56 4e-08 BT022288-1|AAY54704.1| 424|Drosophila melanogaster IP11372p pro... 56 4e-08 BT022236-1|AAY54652.1| 424|Drosophila melanogaster IP11472p pro... 56 4e-08 AE014296-3164|AAF49151.1| 401|Drosophila melanogaster CG9295-PB... 56 4e-08 AE014296-3163|AAF49152.1| 198|Drosophila melanogaster CG9290-PA... 55 1e-07 M71249-1|AAA28501.1| 188|Drosophila melanogaster cuticle protei... 54 3e-07 AE014297-496|AAF54097.2| 188|Drosophila melanogaster CG2345-PA ... 54 3e-07 AE001572-20|AAD19810.1| 188|Drosophila melanogaster pupal-cutic... 54 3e-07 AE014297-502|AAF54091.1| 221|Drosophila melanogaster CG1252-PA ... 52 7e-07 AE001572-14|AAD19804.1| 221|Drosophila melanogaster cuticle pro... 52 7e-07 AE014297-501|AAF54092.1| 217|Drosophila melanogaster CG1327-PA ... 52 1e-06 AE001572-15|AAD19805.1| 217|Drosophila melanogaster cuticle pro... 52 1e-06 BT023126-1|AAY55542.1| 245|Drosophila melanogaster IP08764p pro... 52 1e-06 BT023042-1|AAY55458.1| 245|Drosophila melanogaster IP08564p pro... 52 1e-06 AE014297-2676|AAF55678.2| 245|Drosophila melanogaster CG6240-PA... 52 1e-06 Y18453-1|CAA77177.1| 472|Drosophila melanogaster drosocrystalli... 51 2e-06 AY119178-1|AAM51038.1| 477|Drosophila melanogaster RH66281p pro... 51 2e-06 AE014134-2114|AAF53134.2| 477|Drosophila melanogaster CG16963-P... 51 2e-06 AM294620-1|CAL26618.1| 204|Drosophila melanogaster CG9283 protein. 50 3e-06 AM294619-1|CAL26617.1| 204|Drosophila melanogaster CG9283 protein. 50 3e-06 AM294618-1|CAL26616.1| 204|Drosophila melanogaster CG9283 protein. 50 3e-06 AM294617-1|CAL26615.1| 204|Drosophila melanogaster CG9283 protein. 50 3e-06 AM294616-1|CAL26614.1| 204|Drosophila melanogaster CG9283 protein. 50 3e-06 AM294614-1|CAL26612.1| 204|Drosophila melanogaster CG9283 protein. 50 3e-06 AM294613-1|CAL26611.1| 204|Drosophila melanogaster CG9283 protein. 50 3e-06 AM294612-1|CAL26610.1| 204|Drosophila melanogaster CG9283 protein. 50 3e-06 AM294611-1|CAL26609.1| 204|Drosophila melanogaster CG9283 protein. 50 3e-06 AM294610-1|CAL26608.1| 204|Drosophila melanogaster CG9283 protein. 50 3e-06 AM294609-1|CAL26607.1| 204|Drosophila melanogaster CG9283 protein. 50 3e-06 AE014296-3162|AAF49153.1| 204|Drosophila melanogaster CG9283-PA... 50 3e-06 BT011017-1|AAR30177.1| 205|Drosophila melanogaster RH14104p pro... 50 4e-06 AE014297-503|AAF54090.1| 205|Drosophila melanogaster CG2360-PA ... 50 4e-06 AE001572-13|AAD19803.1| 205|Drosophila melanogaster cuticle pro... 50 4e-06 AY070676-1|AAL48147.1| 221|Drosophila melanogaster RH13984p pro... 50 5e-06 AY070951-1|AAL48573.1| 208|Drosophila melanogaster RE04882p pro... 48 1e-05 AE014297-499|AAF54094.1| 208|Drosophila melanogaster CG1330-PA ... 48 1e-05 AE001572-17|AAD19807.1| 208|Drosophila melanogaster cuticle pro... 48 1e-05 AY070590-1|AAL48061.1| 247|Drosophila melanogaster RE69226p pro... 48 2e-05 AE014298-801|AAF46087.1| 145|Drosophila melanogaster CG4052-PA ... 48 2e-05 AE014297-500|AAF54093.1| 199|Drosophila melanogaster CG2341-PA ... 48 2e-05 AE014296-795|AAF47864.2| 247|Drosophila melanogaster CG1259-PB ... 48 2e-05 AE001572-16|AAD19806.1| 199|Drosophila melanogaster cuticle pro... 48 2e-05 AE014134-1731|AAN10713.1| 146|Drosophila melanogaster CG31876-P... 47 3e-05 BT022677-1|AAY55093.1| 202|Drosophila melanogaster IP07124p pro... 47 4e-05 AM294615-1|CAL26613.1| 204|Drosophila melanogaster CG9283 protein. 47 4e-05 AE014296-794|AAF47863.1| 188|Drosophila melanogaster CG15008-PA... 47 4e-05 AY070633-1|AAL48104.1| 192|Drosophila melanogaster RH01578p pro... 46 6e-05 AE014296-792|AAF47861.1| 192|Drosophila melanogaster CG15006-PA... 46 6e-05 AE014297-498|AAF54095.1| 151|Drosophila melanogaster CG1331-PA ... 45 1e-04 AE014134-2498|AAF53397.1| 218|Drosophila melanogaster CG3474-PA... 45 1e-04 AE014134-1650|AAF52783.2| 153|Drosophila melanogaster CG3818-PA... 45 1e-04 AE001572-18|AAD19808.1| 151|Drosophila melanogaster cuticle pro... 45 1e-04 AY071527-1|AAL49149.1| 270|Drosophila melanogaster RE57183p pro... 44 2e-04 AE014296-1500|AAF50383.2| 270|Drosophila melanogaster CG32029-P... 44 2e-04 AY060758-1|AAL28306.1| 178|Drosophila melanogaster GH20904p pro... 44 3e-04 AE013599-1764|AAF58336.1| 178|Drosophila melanogaster CG6305-PA... 44 3e-04 AY121656-1|AAM51983.1| 206|Drosophila melanogaster RE04513p pro... 44 3e-04 AE014297-497|AAF54096.1| 191|Drosophila melanogaster CG2342-PA ... 44 3e-04 AE001572-19|AAD19809.1| 191|Drosophila melanogaster cuticle pro... 44 3e-04 AY071302-1|AAL48924.1| 302|Drosophila melanogaster RE33041p pro... 40 0.004 AE014134-486|AAF51198.2| 302|Drosophila melanogaster CG2973-PA ... 40 0.004 BT024343-1|ABC86405.1| 266|Drosophila melanogaster IP09562p pro... 39 0.007 AE014296-1421|AAF50444.1| 266|Drosophila melanogaster CG13670-P... 39 0.007 BT011451-1|AAR99109.1| 340|Drosophila melanogaster RE37955p pro... 39 0.010 AE014134-1758|AAN10718.1| 340|Drosophila melanogaster CG33302-P... 39 0.010 AE014134-1730|AAN10712.1| 146|Drosophila melanogaster CG31878-P... 38 0.022 AE014134-1729|AAN10711.1| 106|Drosophila melanogaster CG31878-P... 38 0.022 AF037257-1|AAC04785.1| 414|Drosophila melanogaster ES2 protein ... 36 0.089 AE014298-1180|AAF46375.1| 501|Drosophila melanogaster CG1474-PA... 36 0.089 AY069792-1|AAL39937.1| 501|Drosophila melanogaster SD03464p pro... 35 0.16 BT023818-1|AAZ86739.1| 909|Drosophila melanogaster SD18573p pro... 33 0.47 AY128427-1|AAM75020.1| 558|Drosophila melanogaster GH23001p pro... 33 0.47 AM262815-1|CAK18655.1| 1518|Drosophila melanogaster PP1 interact... 33 0.47 AE014297-3239|AAO41591.1| 1744|Drosophila melanogaster CG7029-PA... 33 0.47 AE014134-808|AAF50957.4| 1286|Drosophila melanogaster CG3047-PA ... 31 1.4 AY119070-1|AAM50930.1| 157|Drosophila melanogaster LP08443p pro... 29 5.8 AE014298-611|AAF45929.2| 483|Drosophila melanogaster CG32774-PA... 29 5.8 AE013599-3681|AAF47057.1| 157|Drosophila melanogaster CG11300-P... 29 5.8 >AE014296-3165|AAF49150.3| 1242|Drosophila melanogaster CG9299-PA protein. Length = 1242 Score = 68.9 bits (161), Expect = 8e-12 Identities = 34/59 (57%), Positives = 40/59 (67%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGFQR*RFINS 686 FEY + DPHTGDNK+Q E RDGDVVKGE ++RTVKY AD ++GF INS Sbjct: 1169 FEYAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWETGFHA-EVINS 1226 >BT024400-1|ABC86462.1| 162|Drosophila melanogaster IP05056p protein. Length = 162 Score = 62.9 bits (146), Expect = 5e-10 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F+Y + D HTGD K QHE RDGD VKG+ SIRTV YTADK +GF Sbjct: 91 FKYGVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDGSIRTVDYTADKHNGF 141 >AE014296-1423|AAF50442.1| 162|Drosophila melanogaster CG7076-PA protein. Length = 162 Score = 62.9 bits (146), Expect = 5e-10 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F+Y + D HTGD K QHE RDGD VKG+ SIRTV YTADK +GF Sbjct: 91 FKYGVNDFHTGDVKSQHETRDGDTVKGQYSLVEPDGSIRTVDYTADKHNGF 141 >AY061158-1|AAL28706.1| 180|Drosophila melanogaster LD12613p protein. Length = 180 Score = 62.5 bits (145), Expect = 7e-10 Identities = 28/51 (54%), Positives = 34/51 (66%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 + Y + D HTGD K QHE+RDGDVVKG S+RTV+YTAD +GF Sbjct: 56 YNYGVADSHTGDVKSQHEVRDGDVVKGSYSLVEPDGSVRTVEYTADDHNGF 106 >AE014296-371|AAF47580.1| 180|Drosophila melanogaster CG1919-PA protein. Length = 180 Score = 62.5 bits (145), Expect = 7e-10 Identities = 28/51 (54%), Positives = 34/51 (66%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 + Y + D HTGD K QHE+RDGDVVKG S+RTV+YTAD +GF Sbjct: 56 YNYGVADSHTGDVKSQHEVRDGDVVKGSYSLVEPDGSVRTVEYTADDHNGF 106 >BT016066-1|AAV36951.1| 138|Drosophila melanogaster LP12967p protein. Length = 138 Score = 61.7 bits (143), Expect = 1e-09 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y I+DPHTGD K Q E RDGDVVKG+ S+RTV YTAD +GF Sbjct: 54 FNYGIKDPHTGDIKSQAEERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGF 104 Score = 29.9 bits (64), Expect = 4.4 Identities = 20/59 (33%), Positives = 26/59 (44%) Frame = +1 Query: 493 AYPKYVSNTKLKIPTPVTISTSTRSAMVM**KEKYSLHEADGPFVPLNTQPTKNQGFNA 669 AYPKY N +K P I + K +YSL E DG ++ + GFNA Sbjct: 48 AYPKYSFNYGIKDPHTGDIKSQAEERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGFNA 106 >AE014296-1422|AAF50443.2| 407|Drosophila melanogaster CG7072-PA protein. Length = 407 Score = 61.7 bits (143), Expect = 1e-09 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y I+DPHTGD K Q E RDGDVVKG+ S+RTV YTAD +GF Sbjct: 93 FNYGIKDPHTGDIKSQAEERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGF 143 Score = 29.9 bits (64), Expect = 4.4 Identities = 20/59 (33%), Positives = 26/59 (44%) Frame = +1 Query: 493 AYPKYVSNTKLKIPTPVTISTSTRSAMVM**KEKYSLHEADGPFVPLNTQPTKNQGFNA 669 AYPKY N +K P I + K +YSL E DG ++ + GFNA Sbjct: 87 AYPKYSFNYGIKDPHTGDIKSQAEERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGFNA 145 >BT022916-1|AAY55332.1| 136|Drosophila melanogaster IP04416p protein. Length = 136 Score = 58.0 bits (134), Expect = 1e-08 Identities = 28/54 (51%), Positives = 34/54 (62%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y ++D TGD+K Q E+RDGDVVKG S+RTV YTAD +GF Sbjct: 57 QYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSLRTVFYTADPINGF 110 >AE014296-793|AAF47862.1| 147|Drosophila melanogaster CG15007-PA protein. Length = 147 Score = 58.0 bits (134), Expect = 1e-08 Identities = 28/54 (51%), Positives = 34/54 (62%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y ++D TGD+K Q E+RDGDVVKG S+RTV YTAD +GF Sbjct: 68 QYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSLRTVFYTADPINGF 121 >BT010217-1|AAQ23535.1| 194|Drosophila melanogaster RH05746p protein. Length = 194 Score = 57.2 bits (132), Expect = 3e-08 Identities = 29/51 (56%), Positives = 31/51 (60%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D TGD K QHE RDGDVVKG+ SIRTV YTAD GF Sbjct: 37 FNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHGF 87 >AE014296-370|AAF47579.2| 194|Drosophila melanogaster CG13935-PA protein. Length = 194 Score = 57.2 bits (132), Expect = 3e-08 Identities = 29/51 (56%), Positives = 31/51 (60%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D TGD K QHE RDGDVVKG+ SIRTV YTAD GF Sbjct: 37 FNYGVADHSTGDVKSQHETRDGDVVKGQYSLVEPDGSIRTVDYTADSIHGF 87 >BT022412-1|AAY54828.1| 424|Drosophila melanogaster IP11572p protein. Length = 424 Score = 56.4 bits (130), Expect = 4e-08 Identities = 29/51 (56%), Positives = 31/51 (60%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y ++D HTGD K Q E RDGD VKG SIRTV YTAD K GF Sbjct: 58 FSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGF 108 >BT022352-1|AAY54768.1| 424|Drosophila melanogaster IP11272p protein. Length = 424 Score = 56.4 bits (130), Expect = 4e-08 Identities = 29/51 (56%), Positives = 31/51 (60%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y ++D HTGD K Q E RDGD VKG SIRTV YTAD K GF Sbjct: 58 FSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGF 108 >BT022288-1|AAY54704.1| 424|Drosophila melanogaster IP11372p protein. Length = 424 Score = 56.4 bits (130), Expect = 4e-08 Identities = 29/51 (56%), Positives = 31/51 (60%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y ++D HTGD K Q E RDGD VKG SIRTV YTAD K GF Sbjct: 58 FSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGF 108 >BT022236-1|AAY54652.1| 424|Drosophila melanogaster IP11472p protein. Length = 424 Score = 56.4 bits (130), Expect = 4e-08 Identities = 29/51 (56%), Positives = 31/51 (60%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y ++D HTGD K Q E RDGD VKG SIRTV YTAD K GF Sbjct: 58 FSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGF 108 >AE014296-3164|AAF49151.1| 401|Drosophila melanogaster CG9295-PB protein. Length = 401 Score = 56.4 bits (130), Expect = 4e-08 Identities = 29/51 (56%), Positives = 31/51 (60%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y ++D HTGD K Q E RDGD VKG SIRTV YTAD K GF Sbjct: 35 FSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGF 85 >AE014296-3163|AAF49152.1| 198|Drosophila melanogaster CG9290-PA protein. Length = 198 Score = 55.2 bits (127), Expect = 1e-07 Identities = 25/51 (49%), Positives = 31/51 (60%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F+Y ++D HTGD K Q E RDGD VKG + R V+YTAD +GF Sbjct: 88 FDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRVVEYTADDHNGF 138 >M71249-1|AAA28501.1| 188|Drosophila melanogaster cuticle protein protein. Length = 188 Score = 53.6 bits (123), Expect = 3e-07 Identities = 27/54 (50%), Positives = 31/54 (57%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y ++DP TGD K Q E RDGDVV G+ + RTV YTAD GF Sbjct: 36 QYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGF 89 >AE014297-496|AAF54097.2| 188|Drosophila melanogaster CG2345-PA protein. Length = 188 Score = 53.6 bits (123), Expect = 3e-07 Identities = 27/54 (50%), Positives = 31/54 (57%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y ++DP TGD K Q E RDGDVV G+ + RTV YTAD GF Sbjct: 36 QYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGF 89 >AE001572-20|AAD19810.1| 188|Drosophila melanogaster pupal-cuticle-protein protein. Length = 188 Score = 53.6 bits (123), Expect = 3e-07 Identities = 27/54 (50%), Positives = 31/54 (57%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y ++DP TGD K Q E RDGDVV G+ + RTV YTAD GF Sbjct: 36 QYSFNYDVQDPETGDVKSQSESRDGDVVHGQYSVNDADGYRRTVDYTADDVRGF 89 >AE014297-502|AAF54091.1| 221|Drosophila melanogaster CG1252-PA protein. Length = 221 Score = 52.4 bits (120), Expect = 7e-07 Identities = 28/54 (51%), Positives = 33/54 (61%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y ++D TGDNK Q E RDGDVV+GE RTV+YTAD +GF Sbjct: 61 QYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGF 114 >AE001572-14|AAD19804.1| 221|Drosophila melanogaster cuticle protein protein. Length = 221 Score = 52.4 bits (120), Expect = 7e-07 Identities = 28/54 (51%), Positives = 33/54 (61%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y ++D TGDNK Q E RDGDVV+GE RTV+YTAD +GF Sbjct: 61 QYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGF 114 >AE014297-501|AAF54092.1| 217|Drosophila melanogaster CG1327-PA protein. Length = 217 Score = 52.0 bits (119), Expect = 1e-06 Identities = 26/51 (50%), Positives = 32/51 (62%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y ++D +GD+K Q E RDGDVV+GE RTVKYTAD +GF Sbjct: 67 FAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGF 117 >AE001572-15|AAD19805.1| 217|Drosophila melanogaster cuticle protein protein. Length = 217 Score = 52.0 bits (119), Expect = 1e-06 Identities = 26/51 (50%), Positives = 32/51 (62%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y ++D +GD+K Q E RDGDVV+GE RTVKYTAD +GF Sbjct: 67 FAYDVQDALSGDSKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGF 117 >BT023126-1|AAY55542.1| 245|Drosophila melanogaster IP08764p protein. Length = 245 Score = 51.6 bits (118), Expect = 1e-06 Identities = 27/51 (52%), Positives = 30/51 (58%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y I+D +TGD K QHE R GDVVKG + RTV YTAD GF Sbjct: 70 FGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHGF 120 >BT023042-1|AAY55458.1| 245|Drosophila melanogaster IP08564p protein. Length = 245 Score = 51.6 bits (118), Expect = 1e-06 Identities = 27/51 (52%), Positives = 30/51 (58%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y I+D +TGD K QHE R GDVVKG + RTV YTAD GF Sbjct: 70 FGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHGF 120 >AE014297-2676|AAF55678.2| 245|Drosophila melanogaster CG6240-PA protein. Length = 245 Score = 51.6 bits (118), Expect = 1e-06 Identities = 27/51 (52%), Positives = 30/51 (58%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y I+D +TGD K QHE R GDVVKG + RTV YTAD GF Sbjct: 70 FGYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHGF 120 >Y18453-1|CAA77177.1| 472|Drosophila melanogaster drosocrystallin protein. Length = 472 Score = 51.2 bits (117), Expect = 2e-06 Identities = 26/54 (48%), Positives = 32/54 (59%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y + D TGD+K Q E RDGD+VKG+ + R V+YTAD SGF Sbjct: 76 QYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSGF 129 >AY119178-1|AAM51038.1| 477|Drosophila melanogaster RH66281p protein. Length = 477 Score = 51.2 bits (117), Expect = 2e-06 Identities = 26/54 (48%), Positives = 32/54 (59%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y + D TGD+K Q E RDGD+VKG+ + R V+YTAD SGF Sbjct: 76 QYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSGF 129 >AE014134-2114|AAF53134.2| 477|Drosophila melanogaster CG16963-PA protein. Length = 477 Score = 51.2 bits (117), Expect = 2e-06 Identities = 26/54 (48%), Positives = 32/54 (59%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y + D TGD+K Q E RDGD+VKG+ + R V+YTAD SGF Sbjct: 76 QYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSGF 129 >AM294620-1|CAL26618.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 50.4 bits (115), Expect = 3e-06 Identities = 25/52 (48%), Positives = 29/52 (55%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGFQ 665 F Y ++D TGD K Q E RDGD VKG R V+YTAD +GFQ Sbjct: 102 FNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153 >AM294619-1|CAL26617.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 50.4 bits (115), Expect = 3e-06 Identities = 25/52 (48%), Positives = 29/52 (55%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGFQ 665 F Y ++D TGD K Q E RDGD VKG R V+YTAD +GFQ Sbjct: 102 FNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153 >AM294618-1|CAL26616.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 50.4 bits (115), Expect = 3e-06 Identities = 25/52 (48%), Positives = 29/52 (55%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGFQ 665 F Y ++D TGD K Q E RDGD VKG R V+YTAD +GFQ Sbjct: 102 FNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153 >AM294617-1|CAL26615.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 50.4 bits (115), Expect = 3e-06 Identities = 25/52 (48%), Positives = 29/52 (55%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGFQ 665 F Y ++D TGD K Q E RDGD VKG R V+YTAD +GFQ Sbjct: 102 FNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153 >AM294616-1|CAL26614.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 50.4 bits (115), Expect = 3e-06 Identities = 25/52 (48%), Positives = 29/52 (55%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGFQ 665 F Y ++D TGD K Q E RDGD VKG R V+YTAD +GFQ Sbjct: 102 FNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153 >AM294614-1|CAL26612.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 50.4 bits (115), Expect = 3e-06 Identities = 25/52 (48%), Positives = 29/52 (55%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGFQ 665 F Y ++D TGD K Q E RDGD VKG R V+YTAD +GFQ Sbjct: 102 FNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153 >AM294613-1|CAL26611.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 50.4 bits (115), Expect = 3e-06 Identities = 25/52 (48%), Positives = 29/52 (55%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGFQ 665 F Y ++D TGD K Q E RDGD VKG R V+YTAD +GFQ Sbjct: 102 FNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153 >AM294612-1|CAL26610.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 50.4 bits (115), Expect = 3e-06 Identities = 25/52 (48%), Positives = 29/52 (55%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGFQ 665 F Y ++D TGD K Q E RDGD VKG R V+YTAD +GFQ Sbjct: 102 FNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153 >AM294611-1|CAL26609.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 50.4 bits (115), Expect = 3e-06 Identities = 25/52 (48%), Positives = 29/52 (55%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGFQ 665 F Y ++D TGD K Q E RDGD VKG R V+YTAD +GFQ Sbjct: 102 FNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153 >AM294610-1|CAL26608.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 50.4 bits (115), Expect = 3e-06 Identities = 25/52 (48%), Positives = 29/52 (55%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGFQ 665 F Y ++D TGD K Q E RDGD VKG R V+YTAD +GFQ Sbjct: 102 FNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153 >AM294609-1|CAL26607.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 50.4 bits (115), Expect = 3e-06 Identities = 25/52 (48%), Positives = 29/52 (55%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGFQ 665 F Y ++D TGD K Q E RDGD VKG R V+YTAD +GFQ Sbjct: 102 FNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153 >AE014296-3162|AAF49153.1| 204|Drosophila melanogaster CG9283-PA protein. Length = 204 Score = 50.4 bits (115), Expect = 3e-06 Identities = 25/52 (48%), Positives = 29/52 (55%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGFQ 665 F Y ++D TGD K Q E RDGD VKG R V+YTAD +GFQ Sbjct: 102 FNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQ 153 >BT011017-1|AAR30177.1| 205|Drosophila melanogaster RH14104p protein. Length = 205 Score = 50.0 bits (114), Expect = 4e-06 Identities = 27/54 (50%), Positives = 32/54 (59%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y ++D TGDNK Q E RDGDVV+GE R V+YTAD +GF Sbjct: 61 QYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGF 114 >AE014297-503|AAF54090.1| 205|Drosophila melanogaster CG2360-PA protein. Length = 205 Score = 50.0 bits (114), Expect = 4e-06 Identities = 27/54 (50%), Positives = 32/54 (59%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y ++D TGDNK Q E RDGDVV+GE R V+YTAD +GF Sbjct: 61 QYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGF 114 >AE001572-13|AAD19803.1| 205|Drosophila melanogaster cuticle protein protein. Length = 205 Score = 50.0 bits (114), Expect = 4e-06 Identities = 27/54 (50%), Positives = 32/54 (59%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y ++D TGDNK Q E RDGDVV+GE R V+YTAD +GF Sbjct: 61 QYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGF 114 >AY070676-1|AAL48147.1| 221|Drosophila melanogaster RH13984p protein. Length = 221 Score = 49.6 bits (113), Expect = 5e-06 Identities = 27/54 (50%), Positives = 32/54 (59%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y ++D TGDNK Q E R GDVV+GE RTV+YTAD +GF Sbjct: 61 QYRFSYGVDDKLTGDNKGQVEERGGDVVRGEYSLIDADGYKRTVQYTADPINGF 114 >AY070951-1|AAL48573.1| 208|Drosophila melanogaster RE04882p protein. Length = 208 Score = 48.4 bits (110), Expect = 1e-05 Identities = 25/54 (46%), Positives = 31/54 (57%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q + Y ++D +GDNK E RDGDVV+GE RTV YTAD +GF Sbjct: 50 QYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGF 103 >AE014297-499|AAF54094.1| 208|Drosophila melanogaster CG1330-PA protein. Length = 208 Score = 48.4 bits (110), Expect = 1e-05 Identities = 25/54 (46%), Positives = 31/54 (57%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q + Y ++D +GDNK E RDGDVV+GE RTV YTAD +GF Sbjct: 50 QYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGF 103 >AE001572-17|AAD19807.1| 208|Drosophila melanogaster cuticle protein protein. Length = 208 Score = 48.4 bits (110), Expect = 1e-05 Identities = 25/54 (46%), Positives = 31/54 (57%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q + Y ++D +GDNK E RDGDVV+GE RTV YTAD +GF Sbjct: 50 QYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGF 103 >AY070590-1|AAL48061.1| 247|Drosophila melanogaster RE69226p protein. Length = 247 Score = 48.0 bits (109), Expect = 2e-05 Identities = 25/54 (46%), Positives = 30/54 (55%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y ++D TGD+K Q E RDGDVV+G S R V Y AD +GF Sbjct: 145 QYKFAYDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYADSINGF 198 >AE014298-801|AAF46087.1| 145|Drosophila melanogaster CG4052-PA protein. Length = 145 Score = 48.0 bits (109), Expect = 2e-05 Identities = 25/54 (46%), Positives = 33/54 (61%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q + Y ++D +GD+K Q E RDGDVV+GE RTV+YTAD +GF Sbjct: 63 QYKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGF 116 >AE014297-500|AAF54093.1| 199|Drosophila melanogaster CG2341-PA protein. Length = 199 Score = 48.0 bits (109), Expect = 2e-05 Identities = 25/54 (46%), Positives = 33/54 (61%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q + Y ++D +GD+K Q E RDGDVV+GE RTV+YTAD +GF Sbjct: 61 QYKYAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGF 114 >AE014296-795|AAF47864.2| 247|Drosophila melanogaster CG1259-PB protein. Length = 247 Score = 48.0 bits (109), Expect = 2e-05 Identities = 25/54 (46%), Positives = 30/54 (55%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y ++D TGD+K Q E RDGDVV+G S R V Y AD +GF Sbjct: 145 QYKFAYDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYADSINGF 198 >AE001572-16|AAD19806.1| 199|Drosophila melanogaster cuticle protein protein. Length = 199 Score = 48.0 bits (109), Expect = 2e-05 Identities = 25/54 (46%), Positives = 33/54 (61%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q + Y ++D +GD+K Q E RDGDVV+GE RTV+YTAD +GF Sbjct: 61 QYKYAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGF 114 >AE014134-1731|AAN10713.1| 146|Drosophila melanogaster CG31876-PA protein. Length = 146 Score = 47.2 bits (107), Expect = 3e-05 Identities = 23/51 (45%), Positives = 29/51 (56%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D HTGD K Q E R GD V+G+ +RTV YT+D +GF Sbjct: 47 FAYSVHDEHTGDIKSQTESRKGDQVQGQYTLVDADGYLRTVDYTSDAHNGF 97 >BT022677-1|AAY55093.1| 202|Drosophila melanogaster IP07124p protein. Length = 202 Score = 46.8 bits (106), Expect = 4e-05 Identities = 24/54 (44%), Positives = 29/54 (53%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y + D HTGD+K Q E VV G + +IR V YTADK +GF Sbjct: 105 QYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTYTADKVNGF 158 >AM294615-1|CAL26613.1| 204|Drosophila melanogaster CG9283 protein. Length = 204 Score = 46.8 bits (106), Expect = 4e-05 Identities = 24/52 (46%), Positives = 28/52 (53%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGFQ 665 F Y ++D TGD K Q E RDGD VKG R V+YTA +GFQ Sbjct: 102 FNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTAYSHNGFQ 153 >AE014296-794|AAF47863.1| 188|Drosophila melanogaster CG15008-PA protein. Length = 188 Score = 46.8 bits (106), Expect = 4e-05 Identities = 24/54 (44%), Positives = 29/54 (53%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y + D HTGD+K Q E VV G + +IR V YTADK +GF Sbjct: 91 QYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTYTADKVNGF 144 >AY070633-1|AAL48104.1| 192|Drosophila melanogaster RH01578p protein. Length = 192 Score = 46.0 bits (104), Expect = 6e-05 Identities = 24/54 (44%), Positives = 28/54 (51%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y + D TGD K Q E R GDVV+G + R V+YTAD GF Sbjct: 59 QYTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGF 112 >AE014296-792|AAF47861.1| 192|Drosophila melanogaster CG15006-PA protein. Length = 192 Score = 46.0 bits (104), Expect = 6e-05 Identities = 24/54 (44%), Positives = 28/54 (51%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y + D TGD K Q E R GDVV+G + R V+YTAD GF Sbjct: 59 QYTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGF 112 >AE014297-498|AAF54095.1| 151|Drosophila melanogaster CG1331-PA protein. Length = 151 Score = 44.8 bits (101), Expect = 1e-04 Identities = 24/54 (44%), Positives = 31/54 (57%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y ++D +GD+K Q E RDGDVV GE R V+YT+D +GF Sbjct: 61 QYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGF 114 >AE014134-2498|AAF53397.1| 218|Drosophila melanogaster CG3474-PA protein. Length = 218 Score = 44.8 bits (101), Expect = 1e-04 Identities = 23/52 (44%), Positives = 28/52 (53%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGFQ 665 F+Y ++D TGD K Q E R G V G + RTV YTADK GF+ Sbjct: 74 FQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADGHKRTVHYTADKHKGFE 125 >AE014134-1650|AAF52783.2| 153|Drosophila melanogaster CG3818-PA protein. Length = 153 Score = 44.8 bits (101), Expect = 1e-04 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 2/54 (3%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKG--EIQSSRG*RSIRTVKYTADKKSGFQ 665 F++ + DPHTGD K Q E R D V+G E+ S G R R V+Y AD +GF+ Sbjct: 35 FQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYR--RIVQYKADDHNGFE 86 >AE001572-18|AAD19808.1| 151|Drosophila melanogaster cuticle protein protein. Length = 151 Score = 44.8 bits (101), Expect = 1e-04 Identities = 24/54 (44%), Positives = 31/54 (57%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q F Y ++D +GD+K Q E RDGDVV GE R V+YT+D +GF Sbjct: 61 QYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGF 114 >AY071527-1|AAL49149.1| 270|Drosophila melanogaster RE57183p protein. Length = 270 Score = 44.4 bits (100), Expect = 2e-04 Identities = 22/52 (42%), Positives = 30/52 (57%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGFQ 665 F + ++D + + + EIRDG V+KG IRTVKYTAD K GF+ Sbjct: 160 FGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSDGFIRTVKYTADPKEGFK 211 >AE014296-1500|AAF50383.2| 270|Drosophila melanogaster CG32029-PA protein. Length = 270 Score = 44.4 bits (100), Expect = 2e-04 Identities = 22/52 (42%), Positives = 30/52 (57%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGFQ 665 F + ++D + + + EIRDG V+KG IRTVKYTAD K GF+ Sbjct: 160 FGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSDGFIRTVKYTADPKEGFK 211 >AY060758-1|AAL28306.1| 178|Drosophila melanogaster GH20904p protein. Length = 178 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/52 (44%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEI-RDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 FEY ++DP T N Y H+ DGDVV GE + + V+YTAD K+G+ Sbjct: 92 FEYAVQDPETA-NDYAHKASSDGDVVTGEYRVQMPDGRTQIVRYTADWKTGY 142 >AE013599-1764|AAF58336.1| 178|Drosophila melanogaster CG6305-PA protein. Length = 178 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/52 (44%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEI-RDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 FEY ++DP T N Y H+ DGDVV GE + + V+YTAD K+G+ Sbjct: 92 FEYAVQDPETA-NDYAHKASSDGDVVTGEYRVQMPDGRTQIVRYTADWKTGY 142 >AY121656-1|AAM51983.1| 206|Drosophila melanogaster RE04513p protein. Length = 206 Score = 43.6 bits (98), Expect = 3e-04 Identities = 22/54 (40%), Positives = 32/54 (59%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q + Y ++D +GD+K Q E R+GDVV+G+ + R V YTAD +GF Sbjct: 56 QYTYGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADGYRRIVDYTADPINGF 109 >AE014297-497|AAF54096.1| 191|Drosophila melanogaster CG2342-PA protein. Length = 191 Score = 43.6 bits (98), Expect = 3e-04 Identities = 22/54 (40%), Positives = 32/54 (59%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q + Y ++D +GD+K Q E R+GDVV+G+ + R V YTAD +GF Sbjct: 41 QYTYGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADGYRRIVDYTADPINGF 94 >AE001572-19|AAD19809.1| 191|Drosophila melanogaster cuticle protein protein. Length = 191 Score = 43.6 bits (98), Expect = 3e-04 Identities = 22/54 (40%), Positives = 32/54 (59%) Frame = +3 Query: 501 QICFEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 Q + Y ++D +GD+K Q E R+GDVV+G+ + R V YTAD +GF Sbjct: 41 QYTYGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADGYRRIVDYTADPINGF 94 >AY071302-1|AAL48924.1| 302|Drosophila melanogaster RE33041p protein. Length = 302 Score = 39.9 bits (89), Expect = 0.004 Identities = 23/51 (45%), Positives = 25/51 (49%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D TGD K E RDG VV+G RTV YTAD GF Sbjct: 159 FNYAVNDASTGDIKEHSETRDGYVVRGFYSLIDPDGYKRTVTYTADDVHGF 209 >AE014134-486|AAF51198.2| 302|Drosophila melanogaster CG2973-PA protein. Length = 302 Score = 39.9 bits (89), Expect = 0.004 Identities = 23/51 (45%), Positives = 25/51 (49%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D TGD K E RDG VV+G RTV YTAD GF Sbjct: 159 FNYAVNDASTGDIKEHSETRDGYVVRGFYSLIDPDGYKRTVTYTADDVHGF 209 >BT024343-1|ABC86405.1| 266|Drosophila melanogaster IP09562p protein. Length = 266 Score = 39.1 bits (87), Expect = 0.007 Identities = 21/52 (40%), Positives = 29/52 (55%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGFQ 665 F Y +ED T + + E R+GD V+G ++R VKYTAD +GFQ Sbjct: 105 FAYGVEDGKTRVLQNRKETRNGDEVRGVYSVVDPDGTLRVVKYTADDANGFQ 156 >AE014296-1421|AAF50444.1| 266|Drosophila melanogaster CG13670-PA protein. Length = 266 Score = 39.1 bits (87), Expect = 0.007 Identities = 21/52 (40%), Positives = 29/52 (55%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGFQ 665 F Y +ED T + + E R+GD V+G ++R VKYTAD +GFQ Sbjct: 105 FAYGVEDGKTRVLQNRKETRNGDEVRGVYSVVDPDGTLRVVKYTADDANGFQ 156 >BT011451-1|AAR99109.1| 340|Drosophila melanogaster RE37955p protein. Length = 340 Score = 38.7 bits (86), Expect = 0.010 Identities = 23/51 (45%), Positives = 25/51 (49%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D TGD K Q E RDG V G RTV YTAD +GF Sbjct: 137 FSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGF 187 >AE014134-1758|AAN10718.1| 340|Drosophila melanogaster CG33302-PA protein. Length = 340 Score = 38.7 bits (86), Expect = 0.010 Identities = 23/51 (45%), Positives = 25/51 (49%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D TGD K Q E RDG V G RTV YTAD +GF Sbjct: 137 FSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGF 187 >AE014134-1730|AAN10712.1| 146|Drosophila melanogaster CG31878-PA, isoform A protein. Length = 146 Score = 37.5 bits (83), Expect = 0.022 Identities = 21/51 (41%), Positives = 24/51 (47%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D H+GD K Q E R G+ V G R V YTAD GF Sbjct: 84 FHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVDPDGHRRIVDYTADPLLGF 134 >AE014134-1729|AAN10711.1| 106|Drosophila melanogaster CG31878-PB, isoform B protein. Length = 106 Score = 37.5 bits (83), Expect = 0.022 Identities = 21/51 (41%), Positives = 24/51 (47%) Frame = +3 Query: 510 FEYKIEDPHTGDNKYQHEIRDGDVVKGEIQSSRG*RSIRTVKYTADKKSGF 662 F Y + D H+GD K Q E R G+ V G R V YTAD GF Sbjct: 44 FHYSVHDSHSGDVKDQFEHRRGEYVTGRYSLVDPDGHRRIVDYTADPLLGF 94 >AF037257-1|AAC04785.1| 414|Drosophila melanogaster ES2 protein protein. Length = 414 Score = 35.5 bits (78), Expect = 0.089 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +3 Query: 345 TPSRTYSP*SCDRCSNTPRPSSSCTGTPYSTN 440 +P+ +P S +CSNTP P+S T TP+ST+ Sbjct: 33 SPATFETPVSQAKCSNTPLPNSRATDTPFSTD 64 >AE014298-1180|AAF46375.1| 501|Drosophila melanogaster CG1474-PA protein. Length = 501 Score = 35.5 bits (78), Expect = 0.089 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +3 Query: 345 TPSRTYSP*SCDRCSNTPRPSSSCTGTPYSTN 440 +P+ +P S +CSNTP P+S T TP+ST+ Sbjct: 120 SPATFETPVSQAKCSNTPLPNSRATDTPFSTD 151 >AY069792-1|AAL39937.1| 501|Drosophila melanogaster SD03464p protein. Length = 501 Score = 34.7 bits (76), Expect = 0.16 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +3 Query: 345 TPSRTYSP*SCDRCSNTPRPSSSCTGTPYSTN 440 +P+ +P S +CSNTP P+S T TP+ST+ Sbjct: 120 SPATFETPVSQAKCSNTPLPNSWATDTPFSTD 151 >BT023818-1|AAZ86739.1| 909|Drosophila melanogaster SD18573p protein. Length = 909 Score = 33.1 bits (72), Expect = 0.47 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = +3 Query: 228 TQGIPTGTLVFPKYR---PSRYPS*ANSP*ATTRTASLLCTGTPSRTYSP*SCDRCSNTP 398 T G TG+ P+ R P YP+ +S ++RTA +L T +P+R +P + + N P Sbjct: 764 TSGNSTGSNSAPRSRIPRPVSYPAGRSSTPTSSRTAPVLATPSPARPATPKTVTKSHNKP 823 >AY128427-1|AAM75020.1| 558|Drosophila melanogaster GH23001p protein. Length = 558 Score = 33.1 bits (72), Expect = 0.47 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = +3 Query: 228 TQGIPTGTLVFPKYR---PSRYPS*ANSP*ATTRTASLLCTGTPSRTYSP*SCDRCSNTP 398 T G TG+ P+ R P YP+ +S ++RTA +L T +P+R +P + + N P Sbjct: 413 TSGNSTGSNSAPRSRIPRPVSYPAGRSSTPTSSRTAPVLATPSPARPATPKTVTKSHNKP 472 >AM262815-1|CAK18655.1| 1518|Drosophila melanogaster PP1 interacting 16 protein. Length = 1518 Score = 33.1 bits (72), Expect = 0.47 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = +3 Query: 228 TQGIPTGTLVFPKYR---PSRYPS*ANSP*ATTRTASLLCTGTPSRTYSP*SCDRCSNTP 398 T G TG+ P+ R P YP+ +S ++RTA +L T +P+R +P + + N P Sbjct: 1373 TSGNSTGSNSAPRSRIPRPVSYPAGRSSTPTSSRTAPVLATPSPARPATPKTVTKSHNKP 1432 >AE014297-3239|AAO41591.1| 1744|Drosophila melanogaster CG7029-PA protein. Length = 1744 Score = 33.1 bits (72), Expect = 0.47 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = +3 Query: 228 TQGIPTGTLVFPKYR---PSRYPS*ANSP*ATTRTASLLCTGTPSRTYSP*SCDRCSNTP 398 T G TG+ P+ R P YP+ +S ++RTA +L T +P+R +P + + N P Sbjct: 1599 TSGNSTGSNSAPRSRIPRPVSYPAGRSSTPTSSRTAPVLATPSPARPATPKTVTKSHNKP 1658 >AE014134-808|AAF50957.4| 1286|Drosophila melanogaster CG3047-PA protein. Length = 1286 Score = 31.5 bits (68), Expect = 1.4 Identities = 23/78 (29%), Positives = 35/78 (44%) Frame = +3 Query: 204 TPHPLTRTTQGIPTGTLVFPKYRPSRYPS*ANSP*ATTRTASLLCTGTPSRTYSP*SCDR 383 TP T+T+ PT T P PS +P +TT T++ T T R+ + + R Sbjct: 351 TPRSTTKTSTCAPTTTTPRPTTTPSTSRPTTTTPRSTTTTSTSRPTTTTPRSTTTTTTRR 410 Query: 384 CSNTPRPSSSCTGTPYST 437 + T S++ T T T Sbjct: 411 PTTTTPRSTTTTSTSRPT 428 Score = 31.1 bits (67), Expect = 1.9 Identities = 25/81 (30%), Positives = 37/81 (45%), Gaps = 1/81 (1%) Frame = +3 Query: 198 KPTPHPLTRTTQGIPTGTLVFPKYRPSRYPS*ANSP*ATTRTASLL-CTGTPSRTYSP*S 374 + TP T T+ PT T PS +P +TT+T++ T TP T +P + Sbjct: 317 RTTPRSTTTTSTSRPTTTTPRCTTTPSTSRPTTTTPRSTTKTSTCAPTTTTPRPTTTPST 376 Query: 375 CDRCSNTPRPSSSCTGTPYST 437 + TPR S++ T T T Sbjct: 377 SRPTTTTPR-STTTTSTSRPT 396 >AY119070-1|AAM50930.1| 157|Drosophila melanogaster LP08443p protein. Length = 157 Score = 29.5 bits (63), Expect = 5.8 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 4/51 (7%) Frame = +3 Query: 294 ANSP*ATTRTASLLCTGTPSR----TYSP*SCDRCSNTPRPSSSCTGTPYS 434 A+SP A T T+ TGTP T +P S + TP + TGTP S Sbjct: 31 ASSPPAGTPTSPPPATGTPPSPSPATGTPPSASPAAGTPTSPTPATGTPSS 81 >AE014298-611|AAF45929.2| 483|Drosophila melanogaster CG32774-PA protein. Length = 483 Score = 29.5 bits (63), Expect = 5.8 Identities = 24/78 (30%), Positives = 37/78 (47%) Frame = +3 Query: 204 TPHPLTRTTQGIPTGTLVFPKYRPSRYPS*ANSP*ATTRTASLLCTGTPSRTYSP*SCDR 383 TP T TTQ T TLV + P+ + +P +T+ T++ T T +++ S + + Sbjct: 193 TPPSTTSTTQAPTTTTLVQASTTTTLQPTTSTTPQSTSTTSTQAPTTTTTQSTS--TATQ 250 Query: 384 CSNTPRPSSSCTGTPYST 437 S T S T T ST Sbjct: 251 PSTTTPQSPPTTTTQVST 268 >AE013599-3681|AAF47057.1| 157|Drosophila melanogaster CG11300-PA protein. Length = 157 Score = 29.5 bits (63), Expect = 5.8 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 4/51 (7%) Frame = +3 Query: 294 ANSP*ATTRTASLLCTGTPSR----TYSP*SCDRCSNTPRPSSSCTGTPYS 434 A+SP A T T+ TGTP T +P S + TP + TGTP S Sbjct: 31 ASSPPAGTPTSPPPATGTPPSPSPATGTPPSASPAAGTPTSPTPATGTPSS 81 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,272,194 Number of Sequences: 53049 Number of extensions: 710102 Number of successful extensions: 2191 Number of sequences better than 10.0: 90 Number of HSP's better than 10.0 without gapping: 2040 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2164 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3901127880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -