BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30356 (828 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value D17570-1|BAA04495.1| 351|Homo sapiens zona-pellucida-binding pr... 30 8.9 BT006822-1|AAP35468.1| 351|Homo sapiens zona pellucida binding ... 30 8.9 BC005223-1|AAH05223.1| 351|Homo sapiens zona pellucida binding ... 30 8.9 AC034148-1|AAS07558.1| 320|Homo sapiens unknown protein. 30 8.9 >D17570-1|BAA04495.1| 351|Homo sapiens zona-pellucida-binding protein (sp38) protein. Length = 351 Score = 30.3 bits (65), Expect = 8.9 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = -2 Query: 614 VTGLKTWLKYYTP---KIYKLLQIK*GIYNIRDPYYYF 510 ++G+ T Y P +I K LQ+K IY R+P+YY+ Sbjct: 134 MSGIYTCFLEYKPTVEEIVKRLQLKYAIYAYREPHYYY 171 >BT006822-1|AAP35468.1| 351|Homo sapiens zona pellucida binding protein protein. Length = 351 Score = 30.3 bits (65), Expect = 8.9 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = -2 Query: 614 VTGLKTWLKYYTP---KIYKLLQIK*GIYNIRDPYYYF 510 ++G+ T Y P +I K LQ+K IY R+P+YY+ Sbjct: 134 MSGIYTCFLEYKPTVEEIVKRLQLKYAIYAYREPHYYY 171 >BC005223-1|AAH05223.1| 351|Homo sapiens zona pellucida binding protein protein. Length = 351 Score = 30.3 bits (65), Expect = 8.9 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = -2 Query: 614 VTGLKTWLKYYTP---KIYKLLQIK*GIYNIRDPYYYF 510 ++G+ T Y P +I K LQ+K IY R+P+YY+ Sbjct: 134 MSGIYTCFLEYKPTVEEIVKRLQLKYAIYAYREPHYYY 171 >AC034148-1|AAS07558.1| 320|Homo sapiens unknown protein. Length = 320 Score = 30.3 bits (65), Expect = 8.9 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = -2 Query: 614 VTGLKTWLKYYTP---KIYKLLQIK*GIYNIRDPYYYF 510 ++G+ T Y P +I K LQ+K IY R+P+YY+ Sbjct: 134 MSGIYTCFLEYKPTVEEIVKRLQLKYAIYAYREPHYYY 171 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,187,285 Number of Sequences: 237096 Number of extensions: 2305647 Number of successful extensions: 3799 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3798 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10370898348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -