BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30356 (828 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 2.6 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 3.4 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.4 bits (48), Expect = 2.6 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +2 Query: 266 FTISKLNLDNKFQLTRSSTKTKLKFKLHGIY 358 F I+ +L+N+F + R K K ++ GI+ Sbjct: 9 FEITDYDLENEFNINRPRRKLSKKQQMLGIW 39 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.0 bits (47), Expect = 3.4 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = -3 Query: 778 TVRVPAISPPGLRKPGLATSFKIVKV 701 T+R+ +SPP G+ T +K++ + Sbjct: 1097 TIRISWMSPPLSAANGVITGYKVIVI 1122 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 222,806 Number of Sequences: 438 Number of extensions: 4829 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26460186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -