BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30355 (881 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 77 2e-16 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 2.4 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 76.6 bits (180), Expect = 2e-16 Identities = 37/83 (44%), Positives = 50/83 (60%) Frame = +2 Query: 5 VMRIYGAEGLKTHIRQQIELAQYFAKLVRADERFVIGPEPTMALVCFRLKDGDTITRQLL 184 V+R+YG E L+ IR+ +ELA YF LVR DERF I E + LVCFRLK + I LL Sbjct: 363 VLRLYGIENLQAFIRKHVELAHYFESLVRGDERFEITEEVVLGLVCFRLKASNEINEALL 422 Query: 185 ENITQKKKVFMVAGTHRDRYVIR 253 + + + + +V RD Y +R Sbjct: 423 KRLNGRGVIHLVPSKIRDVYFLR 445 Score = 35.9 bits (79), Expect = 4e-04 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 253 IVICSRLTKKEDVDYSWSQIKKETD 327 + ICSR T+K D+D SW ++K+ D Sbjct: 446 LAICSRFTEKADIDISWKEVKEAAD 470 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.4 bits (48), Expect = 2.4 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = -2 Query: 820 SLVRRTRMDQPYKTMQSANTSAKTNWRLLLCKVIMCRVNHLHGDYITHVNP-FGYW 656 S+ + ++ P Q A TS TN K V +HG Y H P FG W Sbjct: 1386 SVTHQLIVNAPPHAPQIALTSTTTNSLTFKLKPHESDVEPIHG-YTIHYKPEFGDW 1440 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 221,592 Number of Sequences: 336 Number of extensions: 5039 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24410188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -