BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30355 (881 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4139| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.076 SB_56201| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 >SB_4139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 35.1 bits (77), Expect = 0.076 Identities = 14/53 (26%), Positives = 28/53 (52%) Frame = +2 Query: 83 LVRADERFVIGPEPTMALVCFRLKDGDTITRQLLENITQKKKVFMVAGTHRDR 241 +V+ D+ F + + LVCFR K + + L++ + + K+ + G H+ R Sbjct: 1 MVKQDDDFELVVDTNFGLVCFRYKGSEEDNKNLVDILNAEGKILVTPGIHKGR 53 >SB_56201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +2 Query: 575 TISSISAVKQSSAEQSSY*TIKRRTQPPVSKRVHVCDII 691 TI S + K E Y IKRR PP+++ HVC ++ Sbjct: 56 TIESEAEKKAFIVEFVLYEIIKRRKTPPLNRIHHVCYLV 94 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,008,563 Number of Sequences: 59808 Number of extensions: 615415 Number of successful extensions: 1200 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1099 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1199 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2514529411 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -