BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30354 (781 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 23 4.2 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 5.6 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 5.6 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 22.6 bits (46), Expect = 4.2 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +3 Query: 297 AQKPLLDMYLALLVMTFSNSEQLL*FYL 380 A + D+++ LVMTF+ LL +++ Sbjct: 65 ASLAIADLFVGCLVMTFAGVNDLLGYWV 92 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 5.6 Identities = 11/30 (36%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +1 Query: 667 PDCYFYLIP-GHFHSFTLPGTSPGLSPNYS 753 PD +F GHFH+ +P + PN S Sbjct: 118 PDLFFSNEKEGHFHNIIMPNVYIRIFPNGS 147 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 5.6 Identities = 11/30 (36%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +1 Query: 667 PDCYFYLIP-GHFHSFTLPGTSPGLSPNYS 753 PD +F GHFH+ +P + PN S Sbjct: 118 PDLFFSNEKEGHFHNIIMPNVYIRIFPNGS 147 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,556 Number of Sequences: 438 Number of extensions: 3583 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24518154 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -