BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30351 (809 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC24C9.09 |||mitochondrial threonine-tRNA ligase|Schizosacchar... 27 2.4 SPBC26H8.09c |snf59||SWI/SNF complex subunit Snf59|Schizosacchar... 27 2.4 SPAC31A2.11c |cuf1||Cu metalloregulatory transcription factor Cu... 27 3.2 SPAC1527.03 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 27 3.2 SPBC8D2.15 |||mitochondrial lipoic acid synthetase |Schizosaccha... 26 5.5 SPBC691.02c |||RINT1 family protein|Schizosaccharomyces pombe|ch... 26 5.5 SPBC902.04 |||RNA-binding protein|Schizosaccharomyces pombe|chr ... 26 7.3 SPAC19A8.04 |erg5||C-22 sterol desaturase Erg5 |Schizosaccharomy... 25 9.6 >SPAC24C9.09 |||mitochondrial threonine-tRNA ligase|Schizosaccharomyces pombe|chr 1|||Manual Length = 473 Score = 27.5 bits (58), Expect = 2.4 Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -2 Query: 316 RRSLFVT-FFTPGSLLFIHEGSLPWSQPISFLR 221 R+ L+ T TPGS+ F+ G+ +++ + FLR Sbjct: 54 RQKLYTTSILTPGSIFFLPHGTRIYNRLVDFLR 86 >SPBC26H8.09c |snf59||SWI/SNF complex subunit Snf59|Schizosaccharomyces pombe|chr 2|||Manual Length = 515 Score = 27.5 bits (58), Expect = 2.4 Identities = 16/67 (23%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Frame = +3 Query: 291 KKVTNKEXXXXXXXXXXXXXTPKNAVMVINEMIPKEQIANNFKVE-PNPNKHFKQTTPTY 467 K+ TN + + K + + N + + + NFK+E P P+ F+ P Sbjct: 104 KESTNLDDLNMSEEPKHHDSSNKESTNLDNSNMDESENQKNFKIEEPKPSGDFRNEGPKQ 163 Query: 468 CADLTID 488 C D I+ Sbjct: 164 CDDSKIE 170 >SPAC31A2.11c |cuf1||Cu metalloregulatory transcription factor Cuf1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 411 Score = 27.1 bits (57), Expect = 3.2 Identities = 12/52 (23%), Positives = 24/52 (46%) Frame = +1 Query: 19 YMHTIEKKSHISHLVMAFLQHKGRAANHFNLEMDSAVSDEPRDVAEDAACVG 174 Y + I +H+ ++L H + +N+F L A +D ++ C+G Sbjct: 287 YGYEININESTNHVDSSYLPHPIQLSNYFTLPSSCAQADAACQCGDNCECLG 338 >SPAC1527.03 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 475 Score = 27.1 bits (57), Expect = 3.2 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +1 Query: 424 SQTRTSTSSKRPPRTAQTSPLTAPCTKDR*EQAASPQRGRRASRQRHHHQK 576 SQT +S + K P+T++ S AP A S Q G + S ++ Q+ Sbjct: 225 SQTVSSANGKEVPQTSEDSSSQAPHHSSSSGHAPSQQGGNKHSYKKSDSQQ 275 >SPBC8D2.15 |||mitochondrial lipoic acid synthetase |Schizosaccharomyces pombe|chr 2|||Manual Length = 370 Score = 26.2 bits (55), Expect = 5.5 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +3 Query: 237 GWLQGRLPSWMKSKLP 284 G + RLPSW+K+K+P Sbjct: 64 GSIHKRLPSWLKTKVP 79 >SPBC691.02c |||RINT1 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 678 Score = 26.2 bits (55), Expect = 5.5 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +1 Query: 4 VRKH*YMHTIEKKSHISHLVMAFLQHKGRAANHFNLEMDSAV 129 V K H I+ ++ HLV LQ+ R HF+ D + Sbjct: 272 VAKEKLTHIIKYDDYLVHLVHETLQYSVRLEQHFHYTQDPLI 313 >SPBC902.04 |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 589 Score = 25.8 bits (54), Expect = 7.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 802 GPPPFGPAQTGPRRRVPRIP 743 GPP + PA T P +P IP Sbjct: 139 GPPLYHPAATAPSEFMPSIP 158 >SPAC19A8.04 |erg5||C-22 sterol desaturase Erg5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 541 Score = 25.4 bits (53), Expect = 9.6 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -3 Query: 804 PGPRRLAPPKRAPEGVFLEFRKNWPAAGAG 715 P P P + AP G+ + KNW G G Sbjct: 426 PEPETFNPDRWAPNGLAEQSPKNWMVFGNG 455 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,506,112 Number of Sequences: 5004 Number of extensions: 74808 Number of successful extensions: 208 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 196 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 208 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 394431430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -