BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30351 (809 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g50180.1 68416.m05486 hypothetical protein 34 0.097 At2g34430.1 68415.m04223 chlorophyll A-B binding protein / LHCII... 31 1.2 At1g29930.1 68414.m03657 chlorophyll A-B binding protein 2, chlo... 31 1.2 At1g29920.1 68414.m03656 chlorophyll A-B binding protein 165/180... 31 1.2 At1g29910.1 68414.m03655 chlorophyll A-B binding protein 2, chlo... 31 1.2 At1g13220.2 68414.m01534 nuclear matrix constituent protein-rela... 31 1.2 At2g34420.2 68415.m04220 chlorophyll A-B binding protein / LHCII... 30 1.6 At2g34420.1 68415.m04219 chlorophyll A-B binding protein / LHCII... 30 1.6 At5g64700.1 68418.m08132 nodulin MtN21 family protein similar to... 29 2.8 At1g49320.1 68414.m05528 BURP domain-containing protein similari... 29 2.8 At1g18990.1 68414.m02362 expressed protein contains Pfam profile... 29 3.7 At1g23200.1 68414.m02898 pectinesterase family protein contains ... 29 4.8 At4g32750.1 68417.m04660 expressed protein 28 6.4 At4g28810.1 68417.m04119 expressed protein PMID: 12679534, putat... 28 6.4 At3g47580.1 68416.m05180 leucine-rich repeat transmembrane prote... 28 6.4 At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing ... 28 8.4 At5g47210.1 68418.m05821 nuclear RNA-binding protein, putative s... 28 8.4 At4g05616.1 68417.m00870 hypothetical protein 28 8.4 At2g05100.1 68415.m00535 chlorophyll A-B binding protein / LHCII... 28 8.4 At2g05070.1 68415.m00529 chlorophyll A-B binding protein / LHCII... 28 8.4 At1g49270.1 68414.m05524 protein kinase family protein contains ... 28 8.4 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 34.3 bits (75), Expect = 0.097 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -2 Query: 799 PPPFGPAQTGPRRRVPRI-PKKLAGRRGRKQGAILNPSPFPLRRTAL 662 PPP P + GPR R+ + P + R RKQ ++ P P PLR A+ Sbjct: 36 PPPPPPPRLGPRLRLRLLPPPRQQLLRLRKQQPLVLPEPLPLRPRAI 82 >At2g34430.1 68415.m04223 chlorophyll A-B binding protein / LHCII type I (LHB1B1) identical to photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] GI:16366 Length = 266 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 162 SLRRTRQCTTSV*HEWYGGNRRKEIGWLQGRLPSWMKSKLPG 287 ++R+ + T WYG +R K +G G PS++ + PG Sbjct: 34 TMRKASKPTGPSGSPWYGSDRVKYLGPFSGEPPSYLTGEFPG 75 >At1g29930.1 68414.m03657 chlorophyll A-B binding protein 2, chloroplast / LHCII type I CAB-2 / CAB-140 (CAB2B) identical to SP|P04778 Chlorophyll A-B binding protein 2, chloroplast precursor (LHCII type I CAB-2) (CAB-140) (LHCP) {Arabidopsis thaliana} Length = 267 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 207 WYGGNRRKEIGWLQGRLPSWMKSKLPG 287 WYG +R K +G G PS++ + PG Sbjct: 50 WYGSDRVKYLGPFSGESPSYLTGEFPG 76 >At1g29920.1 68414.m03656 chlorophyll A-B binding protein 165/180, chloroplast / LHCII type I CAB-165/180 identical to SP|P04777 Chlorophyll A-B binding protein 165/180, chloroplast precursor (LHCII type I CAB-165/180) (LHCP) {Arabidopsis thaliana}; similar to photosystem II type I chlorophyll a /b binding protein GI:16364 from [Arabidopsis thaliana] Length = 267 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 207 WYGGNRRKEIGWLQGRLPSWMKSKLPG 287 WYG +R K +G G PS++ + PG Sbjct: 50 WYGSDRVKYLGPFSGESPSYLTGEFPG 76 >At1g29910.1 68414.m03655 chlorophyll A-B binding protein 2, chloroplast / LHCII type I CAB-2 / CAB-140 (CAB2A) identical to SP|P04778 Chlorophyll A-B binding protein 2, chloroplast precursor (LHCII type I CAB-2) (CAB-140) (LHCP) {Arabidopsis thaliana} Length = 267 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 207 WYGGNRRKEIGWLQGRLPSWMKSKLPG 287 WYG +R K +G G PS++ + PG Sbjct: 50 WYGSDRVKYLGPFSGESPSYLTGEFPG 76 >At1g13220.2 68414.m01534 nuclear matrix constituent protein-related similar to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 1128 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 100 HFNLEMDSAVSDEPRDVAEDAACVGQDNAPLQFDTNGMEGIEE 228 H+NL V P DV ED A G+D+A + + +EE Sbjct: 997 HYNLRRKKTVDQVPADV-EDNAAAGEDDADIAASAPSKDTVEE 1038 >At2g34420.2 68415.m04220 chlorophyll A-B binding protein / LHCII type I (LHB1B2) identical to GB:X64460 photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] GI:16364 Length = 251 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 207 WYGGNRRKEIGWLQGRLPSWMKSKLPG 287 WYG +R K +G G PS++ + PG Sbjct: 48 WYGSDRVKYLGPFSGEPPSYLTGEFPG 74 >At2g34420.1 68415.m04219 chlorophyll A-B binding protein / LHCII type I (LHB1B2) identical to GB:X64460 photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] GI:16364 Length = 265 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 207 WYGGNRRKEIGWLQGRLPSWMKSKLPG 287 WYG +R K +G G PS++ + PG Sbjct: 48 WYGSDRVKYLGPFSGEPPSYLTGEFPG 74 >At5g64700.1 68418.m08132 nodulin MtN21 family protein similar to MtN21 GI:2598575 (root nodule development) from [Medicago truncatula]; contains Pfam profile PF00892: Integral membrane protein Length = 359 Score = 29.5 bits (63), Expect = 2.8 Identities = 20/53 (37%), Positives = 29/53 (54%) Frame = -2 Query: 427 GSTLKLLAICSLGIISLITMTAFLGVRSRLRCWFCLRRRSLFVTFFTPGSLLF 269 G L+L+A+ G I +T GV L+ W +R +F++ FTP SLLF Sbjct: 249 GWNLRLVAVIYCGFI--VT-----GVAYYLQSWVIEKRGPVFLSMFTPLSLLF 294 >At1g49320.1 68414.m05528 BURP domain-containing protein similarity to SP|Q08298 Dehydration-responsive protein RD22 precursor {Arabidopsis thaliana}; contains Pfam profile PF03181: BURP domain Length = 280 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +2 Query: 86 VGPPI--ISTSRWILQYLMSRVMSPRMQPASDKTMHHFSLTRMVW 214 VGP + + TS W ++ +V+ +M+P S H F L +VW Sbjct: 235 VGPAVCHMDTSTWDADHVAFKVL--KMEPRSAPVCHFFPLDNIVW 277 >At1g18990.1 68414.m02362 expressed protein contains Pfam profile PF04576: Protein of unknown function, DUF593 Length = 524 Score = 29.1 bits (62), Expect = 3.7 Identities = 26/89 (29%), Positives = 39/89 (43%), Gaps = 2/89 (2%) Frame = +1 Query: 1 LVRKH*YMHTIEKKSHISHLVMAFLQHKGRAANHFNLEMDSAVSDEPRDVAEDAACVGQ- 177 LV++ M +E + L L+ + A F E VSD P + + Q Sbjct: 379 LVKREEEMKELEAGIEVYRLRYGLLREERGEAEEFLDEETKPVSDLPVCSSNHEEDLEQM 438 Query: 178 -DNAPLQFDTNGMEGIEEKKLAGSKEDCL 261 D+A NG+ IEE+K GS++D L Sbjct: 439 KDSAEDSIGNNGVMIIEEEKENGSRKDML 467 >At1g23200.1 68414.m02898 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 554 Score = 28.7 bits (61), Expect = 4.8 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 2/61 (3%) Frame = -3 Query: 270 SSTKAVFLGASQFLFFDSL--HTIRVKLKWCIVLSDAGCILGDITRLIRYCRIHLEVEMI 97 SS +VF S + D+L H+ R L+ C + I GD T +++ C I+ M Sbjct: 364 SSDFSVFYACSFKGYQDTLYLHSSRQFLRNCNIYGTVDFIFGDATAILQNCNIYARKPMS 423 Query: 96 G 94 G Sbjct: 424 G 424 >At4g32750.1 68417.m04660 expressed protein Length = 293 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = -3 Query: 318 GDVPCLSLSSLPVVYFSSTKAVFLGASQFLFFDSLHTIRVKLKWCIVLSDAGCIL 154 G V CLS+ ++ A+FLG+S S V L WC +S G ++ Sbjct: 153 GGVRCLSILNVVFAIIYGLLAIFLGSSLLTLGSS---CSVPLFWCYEISSWGLVI 204 >At4g28810.1 68417.m04119 expressed protein PMID: 12679534, putative bHLH127 transcription factor Length = 880 Score = 28.3 bits (60), Expect = 6.4 Identities = 19/61 (31%), Positives = 26/61 (42%) Frame = -1 Query: 773 GPPKACSSNSEKIGRPPGPETRGNFEPFPLPTPKNSFV*SEGRQLESWAAAPLRRARCCS 594 G + SS+ I R G R P P P P + E ++ SW PLR+ CS Sbjct: 699 GQTQIPSSDPLPILRGSGSGGREENTPLPPPLPHQNLFIQED-EMSSWPHHPLRQDYLCS 757 Query: 593 Q 591 + Sbjct: 758 E 758 >At3g47580.1 68416.m05180 leucine-rich repeat transmembrane protein kinase, putative protein kinase Xa21 - Oryza sativa, PIR:A57676 Length = 1011 Score = 28.3 bits (60), Expect = 6.4 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -2 Query: 424 STLKLLAIC-SLGIISLITMTAFLGVRSRLRCWFCLRRRSLFVTFFTPGSLLFIHE 260 S LK +AI S+GI L+ + + S + CWF RR++ P L HE Sbjct: 638 SHLKKVAILVSIGIALLLLLV----IASMVLCWFRKRRKNQQTNNLVPSKLEIFHE 689 >At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing protein Length = 710 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = +1 Query: 502 KDR*EQAASPQRGRRASRQRHHHQKDQEMC*EQHXXXXXXXXXHDSSW 645 KDR E++ R R R+R H++++E H HD W Sbjct: 626 KDR-ERSREHVRDRERERERDRHREERERYGGDHRTRHRDEPEHDEEW 672 >At5g47210.1 68418.m05821 nuclear RNA-binding protein, putative similar to nuclear RNA binding protein GI:6492264 from [Arabidopsis thaliana] Length = 357 Score = 27.9 bits (59), Expect = 8.4 Identities = 18/34 (52%), Positives = 19/34 (55%) Frame = +2 Query: 707 PLFPAPAAGQFFRNSRNTPSGARLGGAKRRGPGF 808 P PAP + Q R SRN P G R GG RG GF Sbjct: 44 PTKPAPPS-QAVRESRNAPQGGR-GGTGGRG-GF 74 >At4g05616.1 68417.m00870 hypothetical protein Length = 346 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = +3 Query: 384 MIPKEQIANNFKVEPNPNKHFKQTTPTYCADLTIDGTVYQG*VRTS 521 M + +AN VE NPN + P A + QG +RT+ Sbjct: 1 MTNNQVLANTVDVEGNPNHPVQTNAPEVAAPTQLQAATSQGQLRTT 46 >At2g05100.1 68415.m00535 chlorophyll A-B binding protein / LHCII type II (LHCB2.1) (LHCB2.3) identical to Lhcb2 protein [Arabidopsis thaliana] GI:4741948, GI:4741944; contains Pfam profile PF00504: Chlorophyll A-B binding protein Length = 265 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 162 SLRRTRQCTTSV*HEWYGGNRRKEIGWLQGRLPSWMKSKLPG 287 ++RRT + T WYG +R K +G PS++ + PG Sbjct: 36 TMRRTVKSTPQ--SIWYGPDRPKYLGPFSENTPSYLTGEYPG 75 >At2g05070.1 68415.m00529 chlorophyll A-B binding protein / LHCII type II (LHCB2.2) identical to Lhcb2 protein [Arabidopsis thaliana] GI:4741946; contains Pfam profile PF00504: Chlorophyll A-B binding protein Length = 265 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 162 SLRRTRQCTTSV*HEWYGGNRRKEIGWLQGRLPSWMKSKLPG 287 ++RRT + T WYG +R K +G PS++ + PG Sbjct: 36 TMRRTVKSTPQ--SIWYGPDRPKYLGPFSENTPSYLTGEYPG 75 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -1 Query: 806 NRAPAVWPRPNGPPKACSSNSEKIGRPPGPETRGNFEPFPLPTP 675 N PA P P PP SSN ++ PP + + P P +P Sbjct: 9 NSPPA--PPPPSPPSPPSSNDQQTTSPPPSDNQETTSPPPPSSP 50 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,348,233 Number of Sequences: 28952 Number of extensions: 447307 Number of successful extensions: 1577 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1573 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1843581600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -