BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30350 (884 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07698.1 68415.m00949 ATP synthase alpha chain, mitochondrial... 142 3e-34 At4g38510.2 68417.m05447 vacuolar ATP synthase subunit B, putati... 46 3e-05 At4g38510.1 68417.m05446 vacuolar ATP synthase subunit B, putati... 46 3e-05 At1g76030.1 68414.m08827 vacuolar ATP synthase subunit B / V-ATP... 46 3e-05 At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putati... 40 0.003 At1g13830.1 68414.m01623 beta-1,3-glucanase-related similar to b... 32 0.58 At3g26510.4 68416.m03309 octicosapeptide/Phox/Bem1p (PB1) domain... 30 1.8 At3g26510.3 68416.m03306 octicosapeptide/Phox/Bem1p (PB1) domain... 30 1.8 At3g26510.2 68416.m03307 octicosapeptide/Phox/Bem1p (PB1) domain... 30 1.8 At3g26510.1 68416.m03308 octicosapeptide/Phox/Bem1p (PB1) domain... 30 1.8 At4g02060.1 68417.m00276 prolifera protein (PRL) / DNA replicati... 29 3.1 At2g21235.1 68415.m02522 bZIP protein-related similar to VirE2-i... 29 4.1 At1g06850.1 68414.m00730 bZIP transcription factor, putative con... 29 5.4 At5g38560.1 68418.m04662 protein kinase family protein contains ... 28 7.2 At4g34380.1 68417.m04884 transducin family protein / WD-40 repea... 28 7.2 At3g03300.1 68416.m00327 DEAD/DEAH box helicase carpel factory-r... 28 9.5 >At2g07698.1 68415.m00949 ATP synthase alpha chain, mitochondrial, putative very strong similarity to SP|P23413 ATP synthase alpha chain, mitochondrial (EC 3.6.3.14) {Brassica campestris}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 777 Score = 142 bits (344), Expect = 3e-34 Identities = 68/75 (90%), Positives = 71/75 (94%) Frame = +3 Query: 30 YPGDVFYLHSRLLERAAKMSDKMGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLE 209 +PGDVFYLHSRLLERAAK SD+ G GSLTALPVIETQAGDVSAYIPTNVISITDGQI LE Sbjct: 567 FPGDVFYLHSRLLERAAKRSDQTGAGSLTALPVIETQAGDVSAYIPTNVISITDGQICLE 626 Query: 210 TELFYKGIRPAINVG 254 TELFY+GIRPAINVG Sbjct: 627 TELFYRGIRPAINVG 641 Score = 130 bits (314), Expect = 1e-30 Identities = 65/83 (78%), Positives = 70/83 (84%) Frame = +2 Query: 254 LSVSRVGSAAQTKAMKQVAGSMKLELAQYREVAAFAQFGSDLDAATQQLLNRGMRLTELL 433 LSVSRVGSAAQ KAMKQV GS KLELAQYREVAAFAQFGSDLDAATQ LLNRG RLTE+ Sbjct: 642 LSVSRVGSAAQLKAMKQVCGSSKLELAQYREVAAFAQFGSDLDAATQALLNRGARLTEVP 701 Query: 434 KQGQYVPMAIEEQVAIIYCGVRG 502 KQ QY P+ IE+Q+ +IY V G Sbjct: 702 KQPQYAPLPIEKQILVIYAAVNG 724 >At4g38510.2 68417.m05447 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative very strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 487 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/75 (32%), Positives = 43/75 (57%) Frame = +3 Query: 27 GYPGDVFYLHSRLLERAAKMSDKMGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFL 206 GYPG ++ + + ERA ++ + G S+T +P++ D++ P IT+GQI++ Sbjct: 299 GYPGYMYTDLATIYERAGRIEGRKG--SITQIPILTMPNDDITHPTPDLTGYITEGQIYI 356 Query: 207 ETELFYKGIRPAINV 251 + +L + I P INV Sbjct: 357 DRQLHNRQIYPPINV 371 >At4g38510.1 68417.m05446 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative very strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 487 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/75 (32%), Positives = 43/75 (57%) Frame = +3 Query: 27 GYPGDVFYLHSRLLERAAKMSDKMGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFL 206 GYPG ++ + + ERA ++ + G S+T +P++ D++ P IT+GQI++ Sbjct: 299 GYPGYMYTDLATIYERAGRIEGRKG--SITQIPILTMPNDDITHPTPDLTGYITEGQIYI 356 Query: 207 ETELFYKGIRPAINV 251 + +L + I P INV Sbjct: 357 DRQLHNRQIYPPINV 371 >At1g76030.1 68414.m08827 vacuolar ATP synthase subunit B / V-ATPase B subunit / vacuolar proton pump B subunit / V-ATPase 57 kDa subunit identical to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana} Length = 486 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/75 (32%), Positives = 43/75 (57%) Frame = +3 Query: 27 GYPGDVFYLHSRLLERAAKMSDKMGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFL 206 GYPG ++ + + ERA ++ + G S+T +P++ D++ P IT+GQI++ Sbjct: 298 GYPGYMYTDLATIYERAGRIEGRKG--SITQIPILTMPNDDITHPTPDLTGYITEGQIYI 355 Query: 207 ETELFYKGIRPAINV 251 + +L + I P INV Sbjct: 356 DRQLHNRQIYPPINV 370 >At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 485 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/71 (30%), Positives = 40/71 (56%), Gaps = 1/71 (1%) Frame = +3 Query: 42 VFYLH-SRLLERAAKMSDKMGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETEL 218 V+Y + + ERA ++ + G S+T +P++ D++ P IT+GQI+++ +L Sbjct: 301 VYYTDLATIYERAGRIEGRKG--SITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQL 358 Query: 219 FYKGIRPAINV 251 + I P INV Sbjct: 359 HNRQIYPPINV 369 >At1g13830.1 68414.m01623 beta-1,3-glucanase-related similar to beta-1,3-glucanase-like protein (GI:14279169) [Olea europaea] similar to Glucan endo-1,3-beta-glucosidase precursor (EC 3.2.1.39) ((1-3)-beta- glucan endohydrolase) ((1-3)-beta-glucanase) (Beta-1,3- endoglucanase) (Swiss-Prot:P52409) [Triticum aestivum] Length = 197 Score = 31.9 bits (69), Expect = 0.58 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +2 Query: 563 SKLATRVCSPRSPKTVRSPPSLTPP 637 S LA P SP + RSPPS TPP Sbjct: 98 SNLANGCIYPSSPSSTRSPPSTTPP 122 >At3g26510.4 68416.m03309 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 521 PPKSLPSRRNLLNTSKLATRVCSPRSPKTVRSPPSLTPP 637 PP +LPS ++S ++ SPRSP + P +PP Sbjct: 126 PPLALPSSTTTSSSSTTSSTSSSPRSPSLSKPPLPPSPP 164 >At3g26510.3 68416.m03306 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 218 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 521 PPKSLPSRRNLLNTSKLATRVCSPRSPKTVRSPPSLTPP 637 PP +LPS ++S ++ SPRSP + P +PP Sbjct: 148 PPLALPSSTTTSSSSTTSSTSSSPRSPSLSKPPLPPSPP 186 >At3g26510.2 68416.m03307 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 521 PPKSLPSRRNLLNTSKLATRVCSPRSPKTVRSPPSLTPP 637 PP +LPS ++S ++ SPRSP + P +PP Sbjct: 126 PPLALPSSTTTSSSSTTSSTSSSPRSPSLSKPPLPPSPP 164 >At3g26510.1 68416.m03308 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein contains Pfam profile PF00564: PB1 domain Length = 196 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 521 PPKSLPSRRNLLNTSKLATRVCSPRSPKTVRSPPSLTPP 637 PP +LPS ++S ++ SPRSP + P +PP Sbjct: 126 PPLALPSSTTTSSSSTTSSTSSSPRSPSLSKPPLPPSPP 164 >At4g02060.1 68417.m00276 prolifera protein (PRL) / DNA replication licensing factor Mcm7 (MCM7) identical to DNA replication licensing factor Mcm7 SP|P43299 PROLIFERA protein {Arabidopsis thaliana}; contains Pfam profile PF00493: MCM2/3/5 family Length = 716 Score = 29.5 bits (63), Expect = 3.1 Identities = 15/55 (27%), Positives = 26/55 (47%) Frame = +2 Query: 446 YVPMAIEEQVAIIYCGVRGHLTSWTPPKSLPSRRNLLNTSKLATRVCSPRSPKTV 610 YVP +EE +A Y +R P S + R LL+ +++ + R ++V Sbjct: 567 YVPAELEEYIATAYSSIRQEEAKSNTPHSYTTVRTLLSILRISAALARLRFSESV 621 >At2g21235.1 68415.m02522 bZIP protein-related similar to VirE2-interacting protein VIP1 [Arabidopsis thaliana] GI:7258340, tbZIP transcription factor [Arabidopsis thaliana] GI:17065884 Length = 550 Score = 29.1 bits (62), Expect = 4.1 Identities = 21/69 (30%), Positives = 30/69 (43%), Gaps = 3/69 (4%) Frame = +3 Query: 393 SNCSTEECVLLSSSSKDNMCPWLLRNRSPSFTAV---SAVTSQAGPLQNHCLREGIYSTH 563 S+CST S S N PW + SP F+++ S+ S GP G +S Sbjct: 123 SSCSTPSSFSPDSFSHSNTGPWSIPQPSPVFSSIAPASSALSSFGPDSFSHSNTGTWSIP 182 Query: 564 QN*PPGSAL 590 Q P S++ Sbjct: 183 QPSPVFSSI 191 >At1g06850.1 68414.m00730 bZIP transcription factor, putative contains Pfam profile: PF00170 bZIP transcription factor Length = 337 Score = 28.7 bits (61), Expect = 5.4 Identities = 16/45 (35%), Positives = 20/45 (44%) Frame = +3 Query: 480 SFTAVSAVTSQAGPLQNHCLREGIYSTHQN*PPGSALHDRQRRSD 614 SF V ++TS P QN L S N PP + R R S+ Sbjct: 72 SFIDVDSLTSNPNPFQNPSLSSNSVSGAANPPPPPSSRPRHRHSN 116 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +2 Query: 506 LTSWTPPKSLPSRRNLLNTSKLATRVCSPRSPKTVRSPPSLTP 634 + S PP S P + TS T SP P + SPP TP Sbjct: 60 VVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTP 102 >At4g34380.1 68417.m04884 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to Myosin heavy chain kinase B (MHCK B).(SP:P90648) [Dictyostelium discoideum] Length = 495 Score = 28.3 bits (60), Expect = 7.2 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = +3 Query: 417 VLLSSSSKDNMCPWLLRNRSPSFTAVSAVTSQAGPLQNHCLR-EGIYSTHQN*PPGSALH 593 +LLS S+ N+C W S +S +T GP++ CL E + HQ A Sbjct: 379 LLLSGSADKNICVWRRDPSDKSHQCLSVLTGHMGPVK--CLAVEEERACHQGAKASVAEG 436 Query: 594 DRQ 602 DR+ Sbjct: 437 DRK 439 >At3g03300.1 68416.m00327 DEAD/DEAH box helicase carpel factory-related similar to RNA helicase GB:AAF03534 Length = 1317 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 544 KEFTQHIKTSHQGLLSTIAKDGQIT 618 ++ QH T H+GLLST KDG I+ Sbjct: 940 QQLFQHCHTHHEGLLST-KKDGMIS 963 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,753,706 Number of Sequences: 28952 Number of extensions: 452192 Number of successful extensions: 1340 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1267 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1335 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2071520424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -