BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30347 (703 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 23 2.8 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 22 6.5 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 457 YDSAARDTDADLDNDENNLTAVWVVPCAVAANSS 558 YD+A R DLD +E+ + V A+ N S Sbjct: 542 YDAAGRTYLFDLDYNESEEQCPYTVDAAIYGNIS 575 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.8 bits (44), Expect = 6.5 Identities = 8/34 (23%), Positives = 17/34 (50%) Frame = +3 Query: 540 GRGEFLCGSDNRTYSSLCRLDLHNCVHRNKKPVT 641 G ++C + + ++ +L +H H +KP T Sbjct: 200 GEKPYVCKACGKGFTCSKQLKVHTRTHTGEKPYT 233 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,608 Number of Sequences: 438 Number of extensions: 2996 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -