BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30346 (903 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4C3.09 |||acetylglucosaminyltransferase|Schizosaccharomyces ... 26 6.4 SPCC338.16 |pof3||F-box protein Pof3|Schizosaccharomyces pombe|c... 26 6.4 >SPBC4C3.09 |||acetylglucosaminyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 376 Score = 26.2 bits (55), Expect = 6.4 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 393 IELGLVICIQITL*NNFPGSILTSYQHSLDLPVYG 497 + LGL++ IQI FPGS+++S + L +G Sbjct: 28 LNLGLLLGIQIYRDPAFPGSLISSAAYEFGLHKHG 62 >SPCC338.16 |pof3||F-box protein Pof3|Schizosaccharomyces pombe|chr 3|||Manual Length = 577 Score = 26.2 bits (55), Expect = 6.4 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = -1 Query: 792 IFNLWAPFNLLSIYPSNPPLSFHLY*KLLPAI*NGATLIGSSIKNIELLMLIPN 631 ++ +W PF+ L + P++F + K+L +K +EL+ LIP+ Sbjct: 253 LYTIWTPFSELHYFYCATPITFSIASKILSCC--------KKLKQVELVDLIPD 298 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,556,232 Number of Sequences: 5004 Number of extensions: 74826 Number of successful extensions: 137 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 137 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 456499320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -