BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30346 (903 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006664-1|AAF39902.2| 298|Caenorhabditis elegans Serpentine re... 29 3.4 Z47808-8|CAA87777.2| 1087|Caenorhabditis elegans Hypothetical pr... 29 6.0 >AC006664-1|AAF39902.2| 298|Caenorhabditis elegans Serpentine receptor, class bc (class b-like) protein 40 protein. Length = 298 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 494 WSTL*LISYGFIVYVTCIYITRLFMWFNATLRLIRA 601 WST + IV + + TRLFMW +T L +A Sbjct: 172 WSTYQTVILSTIVLFSFAFCTRLFMWSKSTRSLTQA 207 >Z47808-8|CAA87777.2| 1087|Caenorhabditis elegans Hypothetical protein D2013.8a protein. Length = 1087 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 5/41 (12%) Frame = -2 Query: 851 GNWPRDIFKLNPP-----RLMDNSVFLTYGPPLTFFPSIHP 744 GNW R +K PP + NS ++T+ PP+ +HP Sbjct: 589 GNWQRRTYKWWPPVAHEYNISLNSRYVTFLPPIVINAIVHP 629 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,199,157 Number of Sequences: 27780 Number of extensions: 402119 Number of successful extensions: 761 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 761 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2297313942 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -