SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30343
         (828 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC646.02 |cwf11||complexed with Cdc5 protein Cwf11 |Schizosacc...    27   4.3  

>SPBC646.02 |cwf11||complexed with Cdc5 protein Cwf11
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1284

 Score = 26.6 bits (56), Expect = 4.3
 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 3/41 (7%)
 Frame = +2

Query: 11  IFHEPAMY-NVL--RIQWSLTANHLNLTCMKKQYNVIFQLL 124
           + HE  ++ N L  R+   ++ NH+NLTCM   Y   ++ +
Sbjct: 51  LLHELKLFENFLWQRVNTEMSLNHINLTCMLLLYKSKYEYI 91


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,270,591
Number of Sequences: 5004
Number of extensions: 63388
Number of successful extensions: 136
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 132
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 136
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 406444570
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -