BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30343 (828 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47423| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_56454| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 >SB_47423| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 855 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/30 (56%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = -2 Query: 572 SFMGTGILRRSYCYLKSTITVCF-SVTLNC 486 SF+G + RSY LKST+TV F S TL C Sbjct: 27 SFIGREEIPRSYNMLKSTLTVIFSSFTLFC 56 >SB_56454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -3 Query: 670 GARGKVGKKMPFKPNSRKSQSIVTQHLKKSKINH 569 G R K G+K +K + ++S+ +H +KS I+H Sbjct: 471 GTRSKGGQKKRYKDTLKGARSLARKHRRKSTIDH 504 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,840,861 Number of Sequences: 59808 Number of extensions: 463724 Number of successful extensions: 802 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 801 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2323539746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -