BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30343 (828 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70285-2|CAA94289.2| 183|Caenorhabditis elegans Hypothetical pr... 29 3.1 AF188751-1|AAF00548.1| 1083|Caenorhabditis elegans tyrosine kina... 29 5.4 AF078787-11|AAC26948.2| 1083|Caenorhabditis elegans Vegf (vascul... 29 5.4 >Z70285-2|CAA94289.2| 183|Caenorhabditis elegans Hypothetical protein F56C4.2 protein. Length = 183 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -2 Query: 548 RRSYCYLKSTITVCFSVTLNCD*YAINSPFTI*ILST 438 RRSYC+ S C+S+T++C A +P + I+ T Sbjct: 84 RRSYCFYNSR---CYSLTMSCHPVATPTPLLLGIILT 117 >AF188751-1|AAF00548.1| 1083|Caenorhabditis elegans tyrosine kinase receptor T17A3.1 protein. Length = 1083 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 11 IFHEPAMYNVLRIQWSLTANHLNLTCMKKQYNVIFQLL 124 I EPA + V Q+ L HLN+ C+ ++ LL Sbjct: 467 IIREPASFKVFGHQFYLLGTHLNIDCVSTSIPLVDALL 504 >AF078787-11|AAC26948.2| 1083|Caenorhabditis elegans Vegf (vascular endothelial growthfactor) receptor family protein 1 protein. Length = 1083 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 11 IFHEPAMYNVLRIQWSLTANHLNLTCMKKQYNVIFQLL 124 I EPA + V Q+ L HLN+ C+ ++ LL Sbjct: 467 IIREPASFKVFGHQFYLLGTHLNIDCVSTSIPLVDALL 504 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,103,486 Number of Sequences: 27780 Number of extensions: 368958 Number of successful extensions: 678 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 678 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2050970610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -