Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30343
         (828 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g24150.1 68418.m02839 squalene monooxygenase 1,1 / squalene e...    28   6.6  

>At5g24150.1 68418.m02839 squalene monooxygenase 1,1 / squalene
           epoxidase 1,1 (SQP1,1) identical to SP|O65404
          Length = 516

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 3/39 (7%)
 Frame = +3

Query: 666 APRVTLKIWKIFI*GL---KFKKTSPAKKSLPALGETRG 773
           AP+V LK+ KIF+ G+   +  K  P KK    L E +G
Sbjct: 291 APQVPLKLRKIFLKGIDEGEHIKAMPTKKMTATLSEKKG 329


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,730,042
Number of Sequences: 28952
Number of extensions: 323496
Number of successful extensions: 616
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 604
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 616
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1902108000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)