BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30342 (703 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT030159-1|ABN49298.1| 363|Drosophila melanogaster IP17715p pro... 29 4.6 AE013599-2351|AAF57949.1| 366|Drosophila melanogaster CG15615-P... 29 4.6 >BT030159-1|ABN49298.1| 363|Drosophila melanogaster IP17715p protein. Length = 363 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 7/47 (14%) Frame = +1 Query: 556 HHNHIIEHTQKIKIFYRTSHWKKFI-------KI*NERMVYLWHKHW 675 HH HIIEH + + +WKK + KI N +W+ W Sbjct: 62 HHEHIIEHHEHHHEHHDPGYWKKKVTWKEGWKKIWNPAKKQIWNPSW 108 >AE013599-2351|AAF57949.1| 366|Drosophila melanogaster CG15615-PA protein. Length = 366 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 7/47 (14%) Frame = +1 Query: 556 HHNHIIEHTQKIKIFYRTSHWKKFI-------KI*NERMVYLWHKHW 675 HH HIIEH + + +WKK + KI N +W+ W Sbjct: 65 HHEHIIEHHEHHHEHHDPGYWKKKVTWKEGWKKIWNPAKKQIWNPSW 111 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,210,211 Number of Sequences: 53049 Number of extensions: 545694 Number of successful extensions: 1034 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 994 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1034 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3087795150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -