BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS30342 (703 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81063-6|CAB02957.2| 296|Caenorhabditis elegans Hypothetical pr... 28 7.4 AF078792-1|AAC26947.2| 352|Caenorhabditis elegans Serpentine re... 28 7.4 >Z81063-6|CAB02957.2| 296|Caenorhabditis elegans Hypothetical protein F15D3.8 protein. Length = 296 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -1 Query: 478 NIQKEKKKEMKNR*ASFQRKDNIVSI 401 N++K KKEM+N A F++K N + + Sbjct: 67 NLEKGHKKEMRNMSADFRKKKNEIEM 92 >AF078792-1|AAC26947.2| 352|Caenorhabditis elegans Serpentine receptor, class h protein40 protein. Length = 352 Score = 27.9 bits (59), Expect = 7.4 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 1/81 (1%) Frame = +3 Query: 24 TNFKVXPNFCFYTPINPKMVPGAFITNITKVKYYSPRLLNIVTYQAYLFNMTHQALSGVA 203 T+F + F P+N +P + + YYS + NI + + +H LS + Sbjct: 251 TSFYISMCIQFLIPLNVGYIPNIYWNFSVTIDYYSQEINNI----SVVLLTSHCTLSSIV 306 Query: 204 *LIIYLFTSSKHLN-IYNKIV 263 + IY L+ I+NKI+ Sbjct: 307 TIFIYTPYRKFTLDLIFNKIL 327 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,027,772 Number of Sequences: 27780 Number of extensions: 297946 Number of successful extensions: 488 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 483 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 488 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1624019012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -